Lineage for d5deob_ (5deo B:)

  1. Root: SCOPe 2.06
  2. 2089713Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2118897Fold c.26: Adenine nucleotide alpha hydrolase-like [52373] (3 superfamilies)
    core: 3 layers, a/b/a ; parallel beta-sheet of 5 strands, order 32145
  4. 2118898Superfamily c.26.1: Nucleotidylyl transferase [52374] (6 families) (S)
  5. 2119569Family c.26.1.0: automated matches [191377] (1 protein)
    not a true family
  6. 2119570Protein automated matches [190459] (50 species)
    not a true protein
  7. 2119704Species Mycobacterium abscessus [TaxId:561007] [312100] (12 PDB entries)
  8. 2119734Domain d5deob_: 5deo B: [321727]
    automated match to d4ymib_
    complexed with dnd

Details for d5deob_

PDB Entry: 5deo (more details), 2.22 Å

PDB Description: mycobacterium abscessus nadd in complex with nicotinic acid adenine dinucleotide
PDB Compounds: (B:) nicotinate-nucleotide adenylyltransferase

SCOPe Domain Sequences for d5deob_:

Sequence, based on SEQRES records: (download)

>d5deob_ c.26.1.0 (B:) automated matches {Mycobacterium abscessus [TaxId: 561007]}
rrrlgvmggtfdpihnghlvaasevadrfaldevifvptgqpwqkqgrkvspaehrylmt
viatasnprftvsradidrggatytvdtltdlrtahpdadlyfitgadalasilswenwe
qlftlakfigvsrpgyelssdhiahaelppdglslvevpalaisstdcriragqarpiwy
lvpdgvvqyvakhrlys

Sequence, based on observed residues (ATOM records): (download)

>d5deob_ c.26.1.0 (B:) automated matches {Mycobacterium abscessus [TaxId: 561007]}
rrrlgvmggtfdpihnghlvaasevadrfaldevifvptgqrkvspaehrylmtviatas
nprftvsradidrggatytvdtltdlrtahpdadlyfitgadalasilswenweqlftla
kfigvsrpgyelsglslvevpalaisstdcriragqarpiwylvpdgvvqyvakhrlys

SCOPe Domain Coordinates for d5deob_:

Click to download the PDB-style file with coordinates for d5deob_.
(The format of our PDB-style files is described here.)

Timeline for d5deob_: