![]() | Class b: All beta proteins [48724] (180 folds) |
![]() | Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
![]() | Superfamily b.1.1: Immunoglobulin [48726] (5 families) ![]() |
![]() | Family b.1.1.0: automated matches [191470] (1 protein) not a true family |
![]() | Protein automated matches [190740] (31 species) not a true protein |
![]() | Species Cow (Bos taurus) [TaxId:9913] [226022] (18 PDB entries) |
![]() | Domain d5e99l1: 5e99 L:3-107 [321725] automated match to d4k3el1 |
PDB Entry: 5e99 (more details), 2.06 Å
SCOPe Domain Sequences for d5e99l1:
Sequence; same for both SEQRES and ATOM records: (download)
>d5e99l1 b.1.1.0 (L:3-107) automated matches {Cow (Bos taurus) [TaxId: 9913]} vlnqpssvsgslgqrvsitcsgsssnvgngyvswyqlipgsaprtliygdtsrasgvpdr fsgsrsgntatltisslqaedeadyfcasaedsssnavfgsgttltvlg
Timeline for d5e99l1: