Lineage for d1dflb2 (1dfl B:5-28,B:77-835)

  1. Root: SCOPe 2.08
  2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
    3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes
  4. Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (27 families) (S)
    division into families based on beta-sheet topologies
  5. Family c.37.1.9: Motor proteins [52641] (5 proteins)
  6. Protein Myosin S1, motor domain [52642] (5 species)
    common fold is interrupted with some all-alpha subdomains
  7. Species Bay scallop (Aequipecten irradians) [TaxId:31199] [52644] (11 PDB entries)
    Uniprot P24733 3-836 ! Uniprot P24733 6-837
  8. Domain d1dflb2: 1dfl B:5-28,B:77-835 [32172]
    Other proteins in same PDB: d1dfla1, d1dflb1, d1dflw_, d1dflx_, d1dfly_, d1dflz_
    complexed with adp, ca, mg, vo4

Details for d1dflb2

PDB Entry: 1dfl (more details), 4.2 Å

PDB Description: scallop myosin s1 complexed with mgadp:vanadate-transition state
PDB Compounds: (B:) myosin head

SCOPe Domain Sequences for d1dflb2:

Sequence, based on SEQRES records: (download)

>d1dflb2 c.37.1.9 (B:5-28,B:77-835) Myosin S1, motor domain {Bay scallop (Aequipecten irradians) [TaxId: 31199]}
fsdpdfqylavdrkklmkeqtaafXmnppkfekledmanmtylneasvlynlrsrytsgl
iytysglfciavnpyrrlpiytdsviakyrgkrkteipphlfsvadnayqnmvtdrenqs
clitgesgagktentkkvimylakvacavkkkdeeasdkkegsledqiiqanpvleaygn
akttrnnnssrfgkfirihfgptgkiagadietylleksrvtyqqsaernyhifyqicsn
aipelndvmlvtpdsglysfinqgcltvdniddveefklcdeafdilgftkeekqsmfkc
tasilhmgemkfkqrpreeqaesdgtaeaekvaflcginagdllkallkpkvkvgtemvt
kgqnmnqvvnsvgalakslydrmfnwlvrrvnktldtkakrnyyigvldiagfeifdfns
feqlcinytnerlqqffnhhmfileqeeykkegiawefidfgmdlqmcidliekpmgils
ileeecmfpkaddksfqdklyqnhmgknrmftkpgkptrpnqgpahfelhhyagnvpysi
tgwleknkdpinenvvallgaskeplvaelfkapeepagggkkkkgkssafqtisavhre
slnklmknlysthphfvrciipnelkqpglvdaelvlhqlqcngvlegiricrkgfpsrl
iysefkqrysilapnaipqgfvdgktvsekilaglqmdpaeyrlgttkvffkagvlgnle
emrderlskiismfqahirgylirkaykklqdqriglsviqrnirkwlvlrnwqwwklys
kvkp

Sequence, based on observed residues (ATOM records): (download)

>d1dflb2 c.37.1.9 (B:5-28,B:77-835) Myosin S1, motor domain {Bay scallop (Aequipecten irradians) [TaxId: 31199]}
fsdpdfqylavdqtaafXmnppkfekledmanmtylneasvlynlrsrytsgliytysgl
fciavnpyrrlpiytdsviakyrgkrkteipphlfsvadnayqnmvtdrenqsclitges
gagktentkkvimylakvedqiiqanpvleaygnakttrnnnssrfgkfirihfgptgki
agadietylleksrvtyqqsaernyhifyqicsnaipelndvmlvtpdsglysfinqgcl
tvdniddveefklcdeafdilgftkeekqsmfkctasilhmgemkfkqaesdgtaeaekv
aflcginagdllkallkpkvtkgqnmnqvvnsvgalakslydrmfnwlvrrvnktldtka
krnyyigvldiagfeifdfnsfeqlcinytnerlqqffnhhmfileqeeykkegiawefi
dfgmdlqmcidliekpmgilsileeecmfpkaddksfqdklyqnhmgknrmftkpgkptr
pnqgpahfelhhyagnvpysitgwleknkdpinenvvallgaskeplvaeqtisavhres
lnklmknlysthphfvrciipnelkqpglvdaelvlhqlqcngvlegiricrkgfpsrli
ysefkqrysilapnaipdgktvsekilaglqmdpaeyrlgttkvffkagvlgnleemrde
rlskiismfqahirgylirkaykklqdqriglsviqrnirkwlvlrnwqwwklyskvkp

SCOPe Domain Coordinates for d1dflb2 are not available.

Timeline for d1dflb2:

Domains from same chain:
(mouse over for more information)
d1dflb1
Domains from other chains:
(mouse over for more information)
d1dfla1, d1dfla2, d1dflw_, d1dflx_, d1dfly_, d1dflz_