Lineage for d5dmbd_ (5dmb D:)

  1. Root: SCOPe 2.07
  2. 2344607Class b: All beta proteins [48724] (178 folds)
  3. 2412587Fold b.151: CsrA-like [117129] (1 superfamily)
    sandwich; 10 strands in 2 sheets; intertwined dimer (segment-swapped, 5-stranded greek-key sandwich?)
  4. 2412588Superfamily b.151.1: CsrA-like [117130] (2 families) (S)
  5. 2412627Family b.151.1.0: automated matches [321708] (1 protein)
    not a true family
  6. 2412628Protein automated matches [321709] (2 species)
    not a true protein
  7. 2412631Species Geobacillus thermodenitrificans [TaxId:33940] [321710] (1 PDB entry)
  8. 2412632Domain d5dmbd_: 5dmb D: [321711]
    automated match to d1y00a_

Details for d5dmbd_

PDB Entry: 5dmb (more details), 2.3 Å

PDB Description: crystal structure of a translational regulator bound to a flagellar assembly factor
PDB Compounds: (D:) carbon storage regulator homolog

SCOPe Domain Sequences for d5dmbd_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5dmbd_ b.151.1.0 (D:) automated matches {Geobacillus thermodenitrificans [TaxId: 33940]}
lvltrklkeaiqigddieitvlaiqgdqvklginapkhveihrkeiylaiqaennaasha
sksslkrlneql

SCOPe Domain Coordinates for d5dmbd_:

Click to download the PDB-style file with coordinates for d5dmbd_.
(The format of our PDB-style files is described here.)

Timeline for d5dmbd_: