| Class b: All beta proteins [48724] (180 folds) |
| Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
Superfamily b.1.1: Immunoglobulin [48726] (5 families) ![]() |
| Family b.1.1.0: automated matches [191470] (1 protein) not a true family |
| Protein automated matches [190740] (31 species) not a true protein |
| Species Mouse (Mus musculus) [TaxId:10090] [188198] (836 PDB entries) |
| Domain d5e94c1: 5e94 C:1-107 [321703] automated match to d2v7ha1 |
PDB Entry: 5e94 (more details), 2 Å
SCOPe Domain Sequences for d5e94c1:
Sequence; same for both SEQRES and ATOM records: (download)
>d5e94c1 b.1.1.0 (C:1-107) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
diqmtqttsslsaslgdrvtiscrasqdisnylnwyqqkpdgtvklliyytsrlhsgvps
rfsgsgsgtdysltissleqedvatyfcqqgntlpftfgsgtkleik
Timeline for d5e94c1:
View in 3DDomains from other chains: (mouse over for more information) d5e94a1, d5e94a2, d5e94b_, d5e94d_ |