Class b: All beta proteins [48724] (178 folds) |
Fold b.43: Reductase/isomerase/elongation factor common domain [50412] (4 superfamilies) barrel, closed; n=6, S=10; greek-key |
Superfamily b.43.3: Translation proteins [50447] (7 families) |
Family b.43.3.0: automated matches [227211] (1 protein) not a true family |
Protein automated matches [226946] (29 species) not a true protein |
Species Sulfolobus solfataricus [TaxId:2287] [255782] (6 PDB entries) |
Domain d5dsza2: 5dsz A:207-320 [321701] Other proteins in same PDB: d5dsza1, d5dsza3, d5dszb1, d5dszb3 automated match to d4m53a2 |
PDB Entry: 5dsz (more details), 2.5 Å
SCOPe Domain Sequences for d5dsza2:
Sequence; same for both SEQRES and ATOM records: (download)
>d5dsza2 b.43.3.0 (A:207-320) automated matches {Sulfolobus solfataricus [TaxId: 2287]} rdlsqkpvmlvirsfdvnkpgtqfnelkggviggsiiqglfkvdqeikvlpglrvekqgk vsyepiftkissirfgdeefkeakpgglvaigtyldpsltkadnllgsiitlad
Timeline for d5dsza2: