Lineage for d1dfka2 (1dfk A:6-28,A:77-835)

  1. Root: SCOP 1.57
  2. 64291Class c: Alpha and beta proteins (a/b) [51349] (107 folds)
  3. 69448Fold c.37: P-loop containing nucleotide triphosphate hydrolases [52539] (1 superfamily)
  4. 69449Superfamily c.37.1: P-loop containing nucleotide triphosphate hydrolases [52540] (15 families) (S)
  5. 69902Family c.37.1.9: Motor proteins [52641] (3 proteins)
  6. 69930Protein Myosin S1, motor domain [52642] (3 species)
  7. 69931Species Bay scallop (Aequipecten irradians) [TaxId:31199] [52644] (3 PDB entries)
  8. 69933Domain d1dfka2: 1dfk A:6-28,A:77-835 [32170]
    Other proteins in same PDB: d1dfka1, d1dfky_, d1dfkz_

Details for d1dfka2

PDB Entry: 1dfk (more details), 4.2 Å

PDB Description: nucleotide-free scallop myosin s1-near rigor state

SCOP Domain Sequences for d1dfka2:

Sequence, based on SEQRES records: (download)

>d1dfka2 c.37.1.9 (A:6-28,A:77-835) Myosin S1, motor domain {Bay scallop (Aequipecten irradians)}
sdpdfqylavdrkklmkeqtaafXmnppkfekledmanmtylneasvlynlrsrytsgli
ytysglfciavnpyrrlpiytdsviakyrgkrkteipphlfsvadnayqnmvtdrenqsc
litgesgagktentkkvimylakvacavkkkdeeasdkkegsledqiiqanpvleaygna
kttrnnnssrfgkfirihfgptgkiagadietylleksrvtyqqsaernyhifyqicsna
ipelndvmlvtpdsglysfinqgcltvdniddveefklcdeafdilgftkeekqsmfkct
asilhmgemkfkqrpreeqaesdgtaeaekvaflcginagdllkallkpkvkvgtemvtk
gqnmnqvvnsvgalakslydrmfnwlvrrvnktldtkakrnyyigvldiagfeifdfnsf
eqlcinytnerlqqffnhhmfileqeeykkegiawefidfgmdlqmcidliekpmgilsi
leeecmfpkaddksfqdklyqnhmgknrmftkpgkptrpnqgpahfelhhyagnvpysit
gwleknkdpinenvvallgaskeplvaelfkapeepagggkkkkgkssafqtisavhres
lnklmknlysthphfvrciipnelkqpglvdaelvlhqlqcngvlegiricrkgfpsrli
ysefkqrysilapnaipqgfvdgktvsekilaglqmdpaeyrlgttkvffkagvlgnlee
mrderlskiismfqahirgylirkaykklqdqriglsviqrnirkwlvlrnwqwwklysk
vkp

Sequence, based on observed residues (ATOM records): (download)

>d1dfka2 c.37.1.9 (A:6-28,A:77-835) Myosin S1, motor domain {Bay scallop (Aequipecten irradians)}
sdpdfqylavdfXmnppkfekledmanmtylneasvlynlrsrytsgliytysglfciav
npyrrlpiytdsviakyrgkrkteipphlfsvadnayqnmvtdrenqsclitgesgagkt
entkkvimylakvedqiiqanpvleaygrfgkfirihfgptgkiagadietylleksrvt
yqqsaipelndvmlvtpdsglysfinqgcltvdniddveefklcdeafdilgftkeekqs
mfkctasilhmgemkfkaesdgtaeaekvaflcginagdllkallkpkmnqvvnsvgala
kslydrmfnwlvrrvnktldtkakrnyyigvldiagfeifdfnsfeqlcinytnerlqqf
fnhhmfileqeeykkegiawefidfgmdlqmcidliekpmgilsileeecmfpkaddksf
qdklyqnhmgknrmftkpgkpnqgpahfelhhyagnvpysitgwleknkdpinenvvall
gaskeplvaelfkatisavhreslnklmknlysthphfvrciipnelkqpglvdaelvlh
qlqcngvlegiricrkgfpsrliysefkqrysilapnaipgktvsekilaglqmdpaeyr
lgttkvffkagvlgnleemrderlskiismfqahirgylirkaykklqdqriglsviqrn
irkwlvlrnwqwwklyskvkp

SCOP Domain Coordinates for d1dfka2:

Click to download the PDB-style file with coordinates for d1dfka2.
(The format of our PDB-style files is described here.)

Timeline for d1dfka2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1dfka1