| Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
| Fold c.47: Thioredoxin fold [52832] (2 superfamilies) core: 3 layers, a/b/a; mixed beta-sheet of 4 strands, order 4312; strand 3 is antiparallel to the rest |
Superfamily c.47.1: Thioredoxin-like [52833] (24 families) ![]() |
| Family c.47.1.0: automated matches [191312] (1 protein) not a true family |
| Protein automated matches [190056] (195 species) not a true protein |
| Species Azotobacter vinelandii [TaxId:354] [321679] (1 PDB entry) |
| Domain d5abrb_: 5abr B: [321680] automated match to d1m2ab_ complexed with fes |
PDB Entry: 5abr (more details), 2.11 Å
SCOPe Domain Sequences for d5abrb_:
Sequence; same for both SEQRES and ATOM records: (download)
>d5abrb_ c.47.1.0 (B:) automated matches {Azotobacter vinelandii [TaxId: 354]}
pefhificaqnrpaghprgscgakgaegvynafaqvliqknltnrialtttgclgpcqag
anvliypgavmyswvepadaaiiveqhllggepyadkltpaeiw
Timeline for d5abrb_: