Lineage for d5abrb_ (5abr B:)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2876126Fold c.47: Thioredoxin fold [52832] (2 superfamilies)
    core: 3 layers, a/b/a; mixed beta-sheet of 4 strands, order 4312; strand 3 is antiparallel to the rest
  4. 2876127Superfamily c.47.1: Thioredoxin-like [52833] (24 families) (S)
  5. 2878967Family c.47.1.0: automated matches [191312] (1 protein)
    not a true family
  6. 2878968Protein automated matches [190056] (195 species)
    not a true protein
  7. 2879086Species Azotobacter vinelandii [TaxId:354] [321679] (1 PDB entry)
  8. 2879088Domain d5abrb_: 5abr B: [321680]
    automated match to d1m2ab_
    complexed with fes

Details for d5abrb_

PDB Entry: 5abr (more details), 2.11 Å

PDB Description: structure of fesi protein from azotobacter vinelandii
PDB Compounds: (B:) ferredoxin, 2fe-2s

SCOPe Domain Sequences for d5abrb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5abrb_ c.47.1.0 (B:) automated matches {Azotobacter vinelandii [TaxId: 354]}
pefhificaqnrpaghprgscgakgaegvynafaqvliqknltnrialtttgclgpcqag
anvliypgavmyswvepadaaiiveqhllggepyadkltpaeiw

SCOPe Domain Coordinates for d5abrb_:

Click to download the PDB-style file with coordinates for d5abrb_.
(The format of our PDB-style files is described here.)

Timeline for d5abrb_: