Lineage for d1br4g2 (1br4 G:2-33,G:80-821)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2109203Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
    3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes
  4. 2109204Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (26 families) (S)
    division into families based on beta-sheet topologies
  5. 2111568Family c.37.1.9: Motor proteins [52641] (5 protein domains)
  6. 2111652Protein Myosin S1, motor domain [52642] (5 species)
    common fold is interrupted with some all-alpha subdomains
  7. 2111666Species Chicken (Gallus gallus), pectoral muscle [TaxId:9031] [52643] (4 PDB entries)
  8. 2111681Domain d1br4g2: 1br4 G:2-33,G:80-821 [32168]
    Other proteins in same PDB: d1br4a1, d1br4b_, d1br4c1, d1br4d_, d1br4e1, d1br4f_, d1br4g1, d1br4h_
    complexed with adp, bef, mg

Details for d1br4g2

PDB Entry: 1br4 (more details), 3.62 Å

PDB Description: smooth muscle myosin motor domain-essential light chain complex with mgadp.bef3 bound at the active site
PDB Compounds: (G:) myosin

SCOPe Domain Sequences for d1br4g2:

Sequence, based on SEQRES records: (download)

>d1br4g2 c.37.1.9 (G:2-33,G:80-821) Myosin S1, motor domain {Chicken (Gallus gallus), pectoral muscle [TaxId: 9031]}
aqkplsddekflfvdknfvnnplaqadwsakkXppkfskvedmaeltclneasvlhnlre
ryfsgliytysglfcvvinpykqlpiysekiidmykgkkrhempphiyaiadtayrsmlq
dredqsilctgesgagktentkkviqylavvasshkgkkdtsitqgpsfsygelekqllq
anpileafgnaktvkndnssrfgkfirinfdvtgyivganietylleksrairqakdert
fhifyyliagaseqmrndlllegfnnytflsnghvpipaqqddemfqetleamtimgfte
eeqtsilrvvssvlqlgnivfkkerntdqasmpdntaaqkvchlmginvtdftrsiltpr
ikvgrdvvqkaqtkeqadfaiealakakferlfrwiltrvnkaldktkrqgasflgildi
agfeifeinsfeqlcinytneklqqlfnhtmfileqeeyqregiewnfidfgldlqpcie
lierptnppgvlalldeecwfpkatdtsfvekliqeqgnhakfqkskqlkdktefcilhy
agkvtynasawltknmdplndnvtsllnqssdkfvadlwkdvdrivgldqmakmtesslp
sasktkkgmfrtvgqlykeqltklmttlrntnpnfvrciipnhekragkldahlvleqlr
cngvlegiricrqgfpnrivfqefrqryeilaanaipkgfmdgkqacilmikaleldpnl
yrigqskiffrtgvlahleeerdlkitdviiafqaqcrgylarkafakrqqqlgs

Sequence, based on observed residues (ATOM records): (download)

>d1br4g2 c.37.1.9 (G:2-33,G:80-821) Myosin S1, motor domain {Chicken (Gallus gallus), pectoral muscle [TaxId: 9031]}
aqkplsddekflfvdknfvnnplaqadwsakkXppkfskvedmaeltclneasvlhnlre
ryfsgliytysglfcvvinpykqlpiysekiidmykgkkrhempphiyaiadtayrsmlq
dredqsilctgesgagktentkkviqylavvasspsfsygelekqllqanpileafgnak
tvkndnssrfgkfirinfdvtgyivganietylleksrairqakdertfhifyyliagas
eqmrndlllegfnnytflsnghvpipaqqddemfqetleamtimgfteeeqtsilrvvss
vlqlgnivfkkerntdqasmpdntaaqkvchlmginvtdftrsiltprikvgrdvvqkaq
tkeqadfaiealakakferlfrwiltrvnkaldasflgildiagfeifeinsfeqlciny
tneklqqlfnhtmfileqeeyqregiewnfidfgldlqpcielierptnppgvlalldee
cwfpkatdtsfvekliqeqgnhakfqkskqlkdktefcilhyagkvtynasawltknmdp
lndnvtsllnqssdkfvadlwkdvdrivglfrtvgqlykeqltklmttlrntnpnfvrci
ipnhekragkldahlvleqlrcngvlegiricrqgfpnrivfqefrqryeilaanaipkg
fmdgkqacilmikaleldpnlyrigqskiffrtgvlahleeerdlkitdviiafqaqcrg
ylarkafakrqqqlgs

SCOPe Domain Coordinates for d1br4g2:

Click to download the PDB-style file with coordinates for d1br4g2.
(The format of our PDB-style files is described here.)

Timeline for d1br4g2: