SCOPe 2.06: Domain d4zcse_: 4zcs E:

Lineage for d4zcse_ (4zcs E:)

1. Root: SCOPe 2.06

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.26: Adenine nucleotide alpha hydrolase-like [52373] (3 superfamilies)
   core: 3 layers, a/b/a ; parallel beta-sheet of 5 strands, order 32145

4. Superfamily c.26.1: Nucleotidylyl transferase [52374] (6 families)

5. Family c.26.1.0: automated matches [191377] (1 protein)
   not a true family

6. Protein automated matches [190459] (50 species)
   not a true protein

7. Species Plasmodium falciparum [TaxId:36329] [269943] (7 PDB entries)

8. Domain d4zcse_: 4zcs E: [321618]
   automated match to d1coza_
   complexed with cdc, p33

Details for d4zcse_

PDB Entry: 4zcs, 2.45 Å

PDB Description: crystal structure of the c-terminal catalytic domain of plasmodium falciparum ctp:phosphocholine cytidylyltransferase in complex with cdp-choline

PDB Compounds: (E:) Choline-phosphate cytidylyltransferase

SCOPe Domain Sequences for d4zcse_:

Sequence; same for both SEQRES and ATOM records:

>d4zcse_ c.26.1.0 (E:) automated matches {Plasmodium falciparum [TaxId: 36329]}
knvviyadgvydmlhlghmkqleqakklfenttlivgvtsdnetklfkgqvvqtleerte
tlkhirwvdeiispcpwvvtpeflekykidyvahddipyannqkediyawlkragkfkat
qrtegvsttdlivrilknyed

Timeline for d4zcse_:

• d4zcse_ is new in SCOPe 2.06-stable
  
• d4zcse_ appears in SCOPe 2.07
  
• d4zcse_ appears in the current release, SCOPe 2.08