Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.26: Adenine nucleotide alpha hydrolase-like [52373] (3 superfamilies) core: 3 layers, a/b/a ; parallel beta-sheet of 5 strands, order 32145 |
Superfamily c.26.1: Nucleotidylyl transferase [52374] (6 families) |
Family c.26.1.0: automated matches [191377] (1 protein) not a true family |
Protein automated matches [190459] (50 species) not a true protein |
Species Plasmodium falciparum [TaxId:36329] [269943] (7 PDB entries) |
Domain d4zcse_: 4zcs E: [321618] automated match to d1coza_ complexed with cdc, p33 |
PDB Entry: 4zcs (more details), 2.45 Å
SCOPe Domain Sequences for d4zcse_:
Sequence; same for both SEQRES and ATOM records: (download)
>d4zcse_ c.26.1.0 (E:) automated matches {Plasmodium falciparum [TaxId: 36329]} knvviyadgvydmlhlghmkqleqakklfenttlivgvtsdnetklfkgqvvqtleerte tlkhirwvdeiispcpwvvtpeflekykidyvahddipyannqkediyawlkragkfkat qrtegvsttdlivrilknyed
Timeline for d4zcse_: