Lineage for d1br1a2 (1br1 A:2-33,A:80-821)

  1. Root: SCOP 1.75
  2. 814173Class c: Alpha and beta proteins (a/b) [51349] (147 folds)
  3. 829350Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
    3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes
  4. 829351Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (24 families) (S)
    division into families based on beta-sheet topologies
  5. 830794Family c.37.1.9: Motor proteins [52641] (4 proteins)
  6. 830883Protein Myosin S1, motor domain [52642] (5 species)
    common fold is interrupted with some all-alpha subdomains
  7. 830897Species Chicken (Gallus gallus), pectoral muscle [TaxId:9031] [52643] (4 PDB entries)
  8. 830905Domain d1br1a2: 1br1 A:2-33,A:80-821 [32161]
    Other proteins in same PDB: d1br1a1, d1br1b_, d1br1c1, d1br1d_, d1br1e1, d1br1f_, d1br1g1, d1br1h_

Details for d1br1a2

PDB Entry: 1br1 (more details), 3.5 Å

PDB Description: smooth muscle myosin motor domain-essential light chain complex with mgadp.alf4 bound at the active site
PDB Compounds: (A:) myosin

SCOP Domain Sequences for d1br1a2:

Sequence, based on SEQRES records: (download)

>d1br1a2 c.37.1.9 (A:2-33,A:80-821) Myosin S1, motor domain {Chicken (Gallus gallus), pectoral muscle [TaxId: 9031]}
aqkplsddekflfvdknfvnnplaqadwsakkXppkfskvedmaeltclneasvlhnlre
ryfsgliytysglfcvvinpykqlpiysekiidmykgkkrhempphiyaiadtayrsmlq
dredqsilctgesgagktentkkviqylavvasshkgkkdtsitqgpsfsygelekqllq
anpileafgnaktvkndnssrfgkfirinfdvtgyivganietylleksrairqakdert
fhifyyliagaseqmrndlllegfnnytflsnghvpipaqqddemfqetleamtimgfte
eeqtsilrvvssvlqlgnivfkkerntdqasmpdntaaqkvchlmginvtdftrsiltpr
ikvgrdvvqkaqtkeqadfaiealakakferlfrwiltrvnkaldktkrqgasflgildi
agfeifeinsfeqlcinytneklqqlfnhtmfileqeeyqregiewnfidfgldlqpcie
lierptnppgvlalldeecwfpkatdtsfvekliqeqgnhakfqkskqlkdktefcilhy
agkvtynasawltknmdplndnvtsllnqssdkfvadlwkdvdrivgldqmakmtesslp
sasktkkgmfrtvgqlykeqltklmttlrntnpnfvrciipnhekragkldahlvleqlr
cngvlegiricrqgfpnrivfqefrqryeilaanaipkgfmdgkqacilmikaleldpnl
yrigqskiffrtgvlahleeerdlkitdviiafqaqcrgylarkafakrqqqlgs

Sequence, based on observed residues (ATOM records): (download)

>d1br1a2 c.37.1.9 (A:2-33,A:80-821) Myosin S1, motor domain {Chicken (Gallus gallus), pectoral muscle [TaxId: 9031]}
aqkplsddekflfvdknfvnnplaqadwsakkXppkfskvedmaeltclneasvlhnlre
ryfsgliytysglfcvvinpykqlpiysekiidmykgkkrhempphiyaiadtayrsmlq
dredqsilctgesgagktentkkviqylavvasshkgkqgpsfsygelekqllqanpile
afgnaktvkndnssrfgkfirinfdvtgyivganietylleksrairqakdertfhifyy
liagaseqmrndlllegfnnytflsnghvpipaqqddemfqetleamtimgfteeeqtsi
lrvvssvlqlgnivfkkerntdqasmpdntaaqkvchlmginvtdftrsiltprikvgrd
vvqkaqtkeqadfaiealakakferlfrwiltrvnkaldasflgildiagfeifeinsfe
qlcinytneklqqlfnhtmfileqeeyqregiewnfidfgldlqpcielierptnppgvl
alldeecwfpkatdtsfvekliqeqgnhakfqkskqlkdktefcilhyagkvtynasawl
tknmdplndnvtsllnqssdkfvadlwkdvdrivglfrtvgqlykeqltklmttlrntnp
nfvrciipnhekragkldahlvleqlrcngvlegiricrqgfpnrivfqefrqryeilaa
naipkgfmdgkqacilmikaleldpnlyrigqskiffrtgvlahleeerdlkitdviiaf
qaqcrgylarkafakrqqqlgs

SCOP Domain Coordinates for d1br1a2:

Click to download the PDB-style file with coordinates for d1br1a2.
(The format of our PDB-style files is described here.)

Timeline for d1br1a2: