Lineage for d4zcsb_ (4zcs B:)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2860044Fold c.26: Adenine nucleotide alpha hydrolase-like [52373] (3 superfamilies)
    core: 3 layers, a/b/a ; parallel beta-sheet of 5 strands, order 32145
  4. 2860045Superfamily c.26.1: Nucleotidylyl transferase [52374] (6 families) (S)
  5. 2860806Family c.26.1.0: automated matches [191377] (1 protein)
    not a true family
  6. 2860807Protein automated matches [190459] (61 species)
    not a true protein
  7. 2861079Species Plasmodium falciparum [TaxId:36329] [269943] (7 PDB entries)
  8. 2861088Domain d4zcsb_: 4zcs B: [321603]
    automated match to d1coza_
    complexed with cdc, p33

Details for d4zcsb_

PDB Entry: 4zcs (more details), 2.45 Å

PDB Description: crystal structure of the c-terminal catalytic domain of plasmodium falciparum ctp:phosphocholine cytidylyltransferase in complex with cdp-choline
PDB Compounds: (B:) Choline-phosphate cytidylyltransferase

SCOPe Domain Sequences for d4zcsb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4zcsb_ c.26.1.0 (B:) automated matches {Plasmodium falciparum [TaxId: 36329]}
knvviyadgvydmlhlghmkqleqakklfenttlivgvtsdnetklfkgqvvqtleerte
tlkhirwvdeiispcpwvvtpeflekykidyvahddipyannqkediyawlkragkfkat
qrtegvsttdlivrilknye

SCOPe Domain Coordinates for d4zcsb_:

Click to download the PDB-style file with coordinates for d4zcsb_.
(The format of our PDB-style files is described here.)

Timeline for d4zcsb_: