Lineage for d1br2f2 (1br2 F:80-789)

  1. Root: SCOP 1.55
  2. 18352Class c: Alpha and beta proteins (a/b) [51349] (97 folds)
  3. 22942Fold c.37: P-loop containing nucleotide triphosphate hydrolases [52539] (1 superfamily)
  4. 22943Superfamily c.37.1: P-loop containing nucleotide triphosphate hydrolases [52540] (14 families) (S)
  5. 23359Family c.37.1.9: Motor proteins [52641] (3 proteins)
  6. 23376Protein Myosin S1, motor domain [52642] (3 species)
  7. 23382Species Chicken (Gallus gallus), pectoral muscle [TaxId:9031] [52643] (4 PDB entries)
  8. 23389Domain d1br2f2: 1br2 F:80-789 [32160]
    Other proteins in same PDB: d1br2a1, d1br2b1, d1br2c1, d1br2d1, d1br2e1, d1br2f1

Details for d1br2f2

PDB Entry: 1br2 (more details), 2.9 Å

PDB Description: smooth muscle myosin motor domain complexed with mgadp.alf4

SCOP Domain Sequences for d1br2f2:

Sequence, based on SEQRES records: (download)

>d1br2f2 c.37.1.9 (F:80-789) Myosin S1, motor domain {Chicken (Gallus gallus), pectoral muscle}
ppkfskvedmaeltclneasvlhnlreryfsgliytysglfcvvinpykqlpiysekiid
mykgkkrhempphiyaiadtayrsmlqdredqsilctgesgagktentkkviqylavvas
shkgkkdtsitqgpsfsygelekqllqanpileafgnaktvkndnssrfgkfirinfdvt
gyivganietylleksrairqakdertfhifyyliagaseqmrndlllegfnnytflsng
hvpipaqqddemfqetleamtimgfteeeqtsilrvvssvlqlgnivfkkerntdqasmp
dntaaqkvchlmginvtdftrsiltprikvgrdvvqkaqtkeqadfaiealakakferlf
rwiltrvnkaldktkrqgasflgildiagfeifeinsfeqlcinytneklqqlfnhtmfi
leqeeyqregiewnfidfgldlqpcielierptnppgvlalldeecwfpkatdtsfvekl
iqeqgnhakfqkskqlkdktefcilhyagkvtynasawltknmdplndnvtsllnqssdk
fvadlwkdvdrivgldqmakmtesslpsasktkkgmfrtvgqlykeqltklmttlrntnp
nfvrciipnhekragkldahlvleqlrcngvlegiricrqgfpnrivfqefrqryeilaa
naipkgfmdgkqacilmikaleldpnlyrigqskiffrtgvlahleeerd

Sequence, based on observed residues (ATOM records): (download)

>d1br2f2 c.37.1.9 (F:80-789) Myosin S1, motor domain {Chicken (Gallus gallus), pectoral muscle}
ppkfskvedmaeltclneasvlhnlreryfsgliytysglfcvvinpykqlpiysekiid
mykgkkrhempphiyaiadtayrsmlqdredqsilctgesgagktentkkviqylavvas
gelekqllqanpileafgnaktvkndnssrfgkfirinfdvtgyivganietylleksra
irqakdertfhifyyliagaseqmrndlllegfnnytflsnghvpipaqqddemfqetle
amtimgfteeeqtsilrvvssvlqlgnivfkkeqasmpdntaaqkvchlmginvtdftrs
iltpkaqtkeqadfaiealakakferlfrwiltrvnkaldasflgildiagfeifeinsf
eqlcinytneklqqlfnhtmfileqeeyqregiewnfidfgldlqpcielierptnppgv
lalldeecatdtsfvekliqeqgnhakfqksktefcilhyagkvtynasawltknmdpln
dnvtsllnqssdkfvadlwkrtvgqlykeqltklmttlrntnpnfvrciipnhekragkl
dahlvleqlrcngvlegiricrqgfpnrivfqefrqryeilaanaipkgfmdgkqacilm
ikaleldpnlyrigqskiffrtgvlahleeerd

SCOP Domain Coordinates for d1br2f2:

Click to download the PDB-style file with coordinates for d1br2f2.
(The format of our PDB-style files is described here.)

Timeline for d1br2f2: