Lineage for d4zcsd_ (4zcs D:)

  1. Root: SCOPe 2.07
  2. 2413226Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2442470Fold c.26: Adenine nucleotide alpha hydrolase-like [52373] (3 superfamilies)
    core: 3 layers, a/b/a ; parallel beta-sheet of 5 strands, order 32145
  4. 2442471Superfamily c.26.1: Nucleotidylyl transferase [52374] (6 families) (S)
  5. 2443142Family c.26.1.0: automated matches [191377] (1 protein)
    not a true family
  6. 2443143Protein automated matches [190459] (52 species)
    not a true protein
  7. 2443375Species Plasmodium falciparum [TaxId:36329] [269943] (7 PDB entries)
  8. 2443386Domain d4zcsd_: 4zcs D: [321596]
    automated match to d1coza_
    complexed with cdc, p33

Details for d4zcsd_

PDB Entry: 4zcs (more details), 2.45 Å

PDB Description: crystal structure of the c-terminal catalytic domain of plasmodium falciparum ctp:phosphocholine cytidylyltransferase in complex with cdp-choline
PDB Compounds: (D:) Choline-phosphate cytidylyltransferase

SCOPe Domain Sequences for d4zcsd_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4zcsd_ c.26.1.0 (D:) automated matches {Plasmodium falciparum [TaxId: 36329]}
knvviyadgvydmlhlghmkqleqakklfenttlivgvtsdnetklfkgqvvqtleerte
tlkhirwvdeiispcpwvvtpeflekykidyvahddipyannqkediyawlkragkfkat
qrtegvsttdlivrilkny

SCOPe Domain Coordinates for d4zcsd_:

Click to download the PDB-style file with coordinates for d4zcsd_.
(The format of our PDB-style files is described here.)

Timeline for d4zcsd_: