| Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
| Fold c.26: Adenine nucleotide alpha hydrolase-like [52373] (3 superfamilies) core: 3 layers, a/b/a ; parallel beta-sheet of 5 strands, order 32145 |
Superfamily c.26.1: Nucleotidylyl transferase [52374] (6 families) ![]() |
| Family c.26.1.0: automated matches [191377] (1 protein) not a true family |
| Protein automated matches [190459] (61 species) not a true protein |
| Species Plasmodium falciparum [TaxId:36329] [269943] (7 PDB entries) |
| Domain d4zcsa_: 4zcs A: [321593] automated match to d1coza_ complexed with cdc, p33 |
PDB Entry: 4zcs (more details), 2.45 Å
SCOPe Domain Sequences for d4zcsa_:
Sequence; same for both SEQRES and ATOM records: (download)
>d4zcsa_ c.26.1.0 (A:) automated matches {Plasmodium falciparum [TaxId: 36329]}
knvviyadgvydmlhlghmkqleqakklfenttlivgvtsdnetklfkgqvvqtleerte
tlkhirwvdeiispcpwvvtpeflekykidyvahddipyannqkediyawlkragkfkat
qrtegvsttdlivrilknyed
Timeline for d4zcsa_: