Lineage for d1br2d2 (1br2 D:80-789)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2109203Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
    3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes
  4. 2109204Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (26 families) (S)
    division into families based on beta-sheet topologies
  5. 2111568Family c.37.1.9: Motor proteins [52641] (5 protein domains)
  6. 2111652Protein Myosin S1, motor domain [52642] (5 species)
    common fold is interrupted with some all-alpha subdomains
  7. 2111666Species Chicken (Gallus gallus), pectoral muscle [TaxId:9031] [52643] (4 PDB entries)
  8. 2111670Domain d1br2d2: 1br2 D:80-789 [32158]
    Other proteins in same PDB: d1br2a1, d1br2b1, d1br2c1, d1br2d1, d1br2e1, d1br2f1
    complexed with adp, alf, mg

Details for d1br2d2

PDB Entry: 1br2 (more details), 2.9 Å

PDB Description: smooth muscle myosin motor domain complexed with mgadp.alf4
PDB Compounds: (D:) myosin

SCOPe Domain Sequences for d1br2d2:

Sequence, based on SEQRES records: (download)

>d1br2d2 c.37.1.9 (D:80-789) Myosin S1, motor domain {Chicken (Gallus gallus), pectoral muscle [TaxId: 9031]}
ppkfskvedmaeltclneasvlhnlreryfsgliytysglfcvvinpykqlpiysekiid
mykgkkrhempphiyaiadtayrsmlqdredqsilctgesgagktentkkviqylavvas
shkgkkdtsitqgpsfsygelekqllqanpileafgnaktvkndnssrfgkfirinfdvt
gyivganietylleksrairqakdertfhifyyliagaseqmrndlllegfnnytflsng
hvpipaqqddemfqetleamtimgfteeeqtsilrvvssvlqlgnivfkkerntdqasmp
dntaaqkvchlmginvtdftrsiltprikvgrdvvqkaqtkeqadfaiealakakferlf
rwiltrvnkaldktkrqgasflgildiagfeifeinsfeqlcinytneklqqlfnhtmfi
leqeeyqregiewnfidfgldlqpcielierptnppgvlalldeecwfpkatdtsfvekl
iqeqgnhakfqkskqlkdktefcilhyagkvtynasawltknmdplndnvtsllnqssdk
fvadlwkdvdrivgldqmakmtesslpsasktkkgmfrtvgqlykeqltklmttlrntnp
nfvrciipnhekragkldahlvleqlrcngvlegiricrqgfpnrivfqefrqryeilaa
naipkgfmdgkqacilmikaleldpnlyrigqskiffrtgvlahleeerd

Sequence, based on observed residues (ATOM records): (download)

>d1br2d2 c.37.1.9 (D:80-789) Myosin S1, motor domain {Chicken (Gallus gallus), pectoral muscle [TaxId: 9031]}
ppkfskvedmaeltclneasvlhnlreryfsgliytysglfcvvinpykqlpiysekiid
mykgkkrhempphiyaiadtayrsmlqdredqsilctgesgagktentkkviqylavvas
gelekqllqanpileafgnaktvkndnssrfgkfirinfdvtgyivganietylleksra
irqakdertfhifyyliagaseqmrndlllegfnnytflsnghvpipaqqddemfqetle
amtimgfteeeqtsilrvvssvlqlgnivfkkeqasmpdntaaqkvchlmginvtdftrs
iltpkaqtkeqadfaiealakakferlfrwiltrvnkaldasflgildiagfeifeinsf
eqlcinytneklqqlfnhtmfileqeeyqregiewnfidfgldlqpcielierptnppgv
lalldeecatdtsfvekliqeqgnhakfqksktefcilhyagkvtynasawltknmdpln
dnvtsllnqssdkfvadlwkrtvgqlykeqltklmttlrntnpnfvrciipnhekragkl
dahlvleqlrcngvlegiricrqgfpnrivfqefrqryeilaanaipkgfmdgkqacilm
ikaleldpnlyrigqskiffrtgvlahleeerd

SCOPe Domain Coordinates for d1br2d2:

Click to download the PDB-style file with coordinates for d1br2d2.
(The format of our PDB-style files is described here.)

Timeline for d1br2d2: