Lineage for d5lf4u_ (5lf4 U:)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2988339Fold d.153: Ntn hydrolase-like [56234] (2 superfamilies)
    4 layers: alpha/beta/beta/alpha; has an unusual sheet-to-sheet packing
  4. 2988340Superfamily d.153.1: N-terminal nucleophile aminohydrolases (Ntn hydrolases) [56235] (8 families) (S)
    N-terminal residue provides two catalytic groups, nucleophile and proton donor
  5. 2988529Family d.153.1.4: Proteasome subunits [56251] (4 proteins)
  6. 2993312Protein automated matches [190144] (14 species)
    not a true protein
  7. 2995063Species Human (Homo sapiens) [TaxId:9606] [311423] (25 PDB entries)
  8. 2995079Domain d5lf4u_: 5lf4 U: [321547]
    Other proteins in same PDB: d5lf4a_, d5lf4c_, d5lf4e_, d5lf4f_, d5lf4i_, d5lf4k_, d5lf4l_, d5lf4m_, d5lf4n_, d5lf4o_, d5lf4q_, d5lf4s_, d5lf4t_, d5lf4w_, d5lf4y_, d5lf4z_
    automated match to d1irua_
    complexed with 1pe, 6v7, cl, k, mg

Details for d5lf4u_

PDB Entry: 5lf4 (more details), 1.99 Å

PDB Description: human 20s proteasome complex with delanzomib at 2.0 angstrom
PDB Compounds: (U:) Proteasome subunit alpha type-6

SCOPe Domain Sequences for d5lf4u_:

Sequence, based on SEQRES records: (download)

>d5lf4u_ d.153.1.4 (U:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
srgssagfdrhitifspegrlyqveyafkainqggltsvavrgkdxavivtqkkvpdkll
dsstvthlfkitenigcvmtgmtadsrsqvqraryeaanwkykygyeipvdmlckriadi
sqvytqnaemrplgccmiligideeqgpqvykcdpagyyxgfkataagvkqtestsflek
kvkkkfdwtfeqtvetaitclstvlsidfkpseievgvvtvenpkfrilteaeidahlva
laer

Sequence, based on observed residues (ATOM records): (download)

>d5lf4u_ d.153.1.4 (U:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
srgssagfdrhitifspegrlyqveyafkainqggltsvavrgkdxavivtqkkvpdkll
dsstvthlfkitenigcvmtgmtadsrsqvqraryeaanwkykygyeipvdmlckriadi
sqvytqnaemrplgccmiligideeqgpqvykcdpagyyxgfkataagvkqtestsflek
kvkkkqtvetaitclstvlsidfkpseievgvvtvenpkfrilteaeidahlvalaer

SCOPe Domain Coordinates for d5lf4u_:

Click to download the PDB-style file with coordinates for d5lf4u_.
(The format of our PDB-style files is described here.)

Timeline for d5lf4u_: