Lineage for d2mysa2 (2mys A:4-33,A:80-843)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2109203Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
    3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes
  4. 2109204Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (26 families) (S)
    division into families based on beta-sheet topologies
  5. 2111568Family c.37.1.9: Motor proteins [52641] (5 protein domains)
  6. 2111652Protein Myosin S1, motor domain [52642] (5 species)
    common fold is interrupted with some all-alpha subdomains
  7. 2111666Species Chicken (Gallus gallus), pectoral muscle [TaxId:9031] [52643] (4 PDB entries)
  8. 2111673Domain d2mysa2: 2mys A:4-33,A:80-843 [32154]
    Other proteins in same PDB: d2mysa1, d2mysb_, d2mysc_
    complexed with mg, so4

Details for d2mysa2

PDB Entry: 2mys (more details), 2.8 Å

PDB Description: myosin subfragment-1, alpha carbon coordinates only for the two light chains
PDB Compounds: (A:) myosin

SCOPe Domain Sequences for d2mysa2:

Sequence, based on SEQRES records: (download)

>d2mysa2 c.37.1.9 (A:4-33,A:80-843) Myosin S1, motor domain {Chicken (Gallus gallus), pectoral muscle [TaxId: 9031]}
daemaafgeaapylrksekerieaqnkpfdXmnppkydkiedmammthlhepavlynlke
ryaawmiytysglfcvtvnpykwlpvynpkvvlayrgkkrqeapphifsisdnayqfmlt
drenqsilitgesgagktvntkrviqyfatiaasgekkkeeqsgkmqgtledqiisanpl
leafgnaktvrndnssrfgkfirihfgatgklasadietylleksrvtfqlpaersyhif
yqimsnkkpelidmllittnpydyhyvsegeitvpsiddqeelmatdsaidilgfsadek
taiykltgavmhygnlkfkqkqreeqaepdgtevadkaaylmglnsaellkalcyprvgv
gneavtkgetvsevhnsvgalakavyekmflwmvirinqqldtkqprqyfigvldiagfe
ifdfnsfeqlcinftneklqqffnhhmfvleqeeykkegiewefidfgmdlaacieliek
pmgifsileeecmfpkatdtsfknklydehlgksnnfqkpkpakgkaeahfslvhyagtv
dynisgwleknkdplnetviglyqkssvktlallfatyggeaeggggkkggkkkgssfqt
vsalfrenlnklmanlrsthphfvrciipnetktpgamehelvlhqlrcngvlegiricr
kgfpsrvlyadfkqryrvlnasaipegqfmdskkasekllgggdvdhtqyafghtkvffk
agllglleemrddklaeiitatqarcrgflmrveyramverresifciqynvrsfmnvkh
wpwmklffkikpllk

Sequence, based on observed residues (ATOM records): (download)

>d2mysa2 c.37.1.9 (A:4-33,A:80-843) Myosin S1, motor domain {Chicken (Gallus gallus), pectoral muscle [TaxId: 9031]}
daemaafgeaapylrksekerieaqnkpfdXmnppkydkiedmammthlhepavlynlke
ryaawmiytysglfcvtvnpykwlpvynpkvvlayrgkkrqeapphifsisdnayqfmlt
drenqsilitgesgagktvntkrviqyfatiaasgegtledqiisanplleafgnaktvr
ndnssrfgkfirihfgatgklasadietylleksrvtfqlpaersyhifyqimsnkkpel
idmllittnpydyhyvsegeitvpsiddqeelmatdsaidilgfsadektaiykltgavm
hygnlkfkqkqreeqaepdgtevadkaaylmglnsaellkalcyprvgvgneavtkgetv
sevhnsvgalakavyekmflwmvirinqqldtkqprqyfigvldiagfeifdfnsfeqlc
inftneklqqffnhhmfvleqeeykkegiewefidfgmdlaacieliekpmgifsileee
cmfpkatdtsfknklydehlgksnnfqkpkpaaeahfslvhyagtvdynisgwleknkdp
lnetviglyqkssvktlallfatyqtvsalfrenlnklmanlrsthphfvrciipnetkt
pgamehelvlhqlrcngvlegiricrkgfpsrvlyadfkqryrvlnasamdskkasekll
gggdvdhtqyafghtkvffkagllglleemrddklaeiitatqarcrgflmrveyramve
rresifciqynvrsfmnvkhwpwmklffkikpllk

SCOPe Domain Coordinates for d2mysa2:

Click to download the PDB-style file with coordinates for d2mysa2.
(The format of our PDB-style files is described here.)

Timeline for d2mysa2:

View in 3D
Domains from same chain:
(mouse over for more information)
d2mysa1