Lineage for d1dg3a2 (1dg3 A:6-283)

  1. Root: SCOPe 2.05
  2. 1815291Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 1845072Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
    3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes
  4. 1845073Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (25 families) (S)
    division into families based on beta-sheet topologies
  5. 1845934Family c.37.1.8: G proteins [52592] (79 proteins)
    core: mixed beta-sheet of 6 strands, order 231456; strand 2 is antiparallel to the rest
  6. 1846401Protein Interferon-induced guanylate-binding protein 1 (GBP1), N-terminal domain [52639] (1 species)
  7. 1846402Species Human (Homo sapiens) [TaxId:9606] [52640] (2 PDB entries)
  8. 1846404Domain d1dg3a2: 1dg3 A:6-283 [32153]
    Other proteins in same PDB: d1dg3a1

Details for d1dg3a2

PDB Entry: 1dg3 (more details), 1.8 Å

PDB Description: structure of human guanylate binding protein-1 in nucleotide free form
PDB Compounds: (A:) protein (interferon-induced guanylate-binding protein 1)

SCOPe Domain Sequences for d1dg3a2:

Sequence, based on SEQRES records: (download)

>d1dg3a2 c.37.1.8 (A:6-283) Interferon-induced guanylate-binding protein 1 (GBP1), N-terminal domain {Human (Homo sapiens) [TaxId: 9606]}
hmtgpmclientngrlmanpealkilsaitqpmvvvaivglyrtgksylmnklagkkkgf
slgstvqshtkgiwmwcvphpkkpghilvlldteglgdvekgdnqndswifalavllsst
fvynsigtinqqamdqlyyvtelthrirsksspdenenevedsadfvsffpdfvwtlrdf
sldleadgqpltpdeyltyslklkkgtsqkdetfnlprlcirkffpkkkcfvfdrpvhrr
klaqleklqdeeldpefvqqvadfcsyifsnsktktls

Sequence, based on observed residues (ATOM records): (download)

>d1dg3a2 c.37.1.8 (A:6-283) Interferon-induced guanylate-binding protein 1 (GBP1), N-terminal domain {Human (Homo sapiens) [TaxId: 9606]}
hmtgpmclientngrlmanpealkilsaitqpmvvvaivglyrtgksylmnklagkkhtk
giwmwcvphpkkpghilvlldteglgdvekgdnqndswifalavllsstfvynsigtinq
qamdqlyyvtelthrirsksdsadfvsffpdfvwtlrdfsldlqpltpdeyltyslklkk
gtsqkdetfnlprlcirkffpkkkcfvfdrpvheldpefvqqvadfcsyifsnsktktls

SCOPe Domain Coordinates for d1dg3a2:

Click to download the PDB-style file with coordinates for d1dg3a2.
(The format of our PDB-style files is described here.)

Timeline for d1dg3a2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1dg3a1