Lineage for d5lf4e_ (5lf4 E:)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2988339Fold d.153: Ntn hydrolase-like [56234] (2 superfamilies)
    4 layers: alpha/beta/beta/alpha; has an unusual sheet-to-sheet packing
  4. 2988340Superfamily d.153.1: N-terminal nucleophile aminohydrolases (Ntn hydrolases) [56235] (8 families) (S)
    N-terminal residue provides two catalytic groups, nucleophile and proton donor
  5. 2995888Family d.153.1.0: automated matches [191393] (1 protein)
    not a true family
  6. 2995889Protein automated matches [190509] (19 species)
    not a true protein
  7. 2996355Species Human (Homo sapiens) [TaxId:9606] [311424] (13 PDB entries)
  8. 2996364Domain d5lf4e_: 5lf4 E: [321525]
    Other proteins in same PDB: d5lf4a_, d5lf4b_, d5lf4d_, d5lf4g_, d5lf4h_, d5lf4j_, d5lf4k_, d5lf4l_, d5lf4n_, d5lf4o_, d5lf4p_, d5lf4r_, d5lf4u_, d5lf4v_, d5lf4x_, d5lf4y_, d5lf4z_
    automated match to d4g4se_
    complexed with 1pe, 6v7, cl, k, mg

Details for d5lf4e_

PDB Entry: 5lf4 (more details), 1.99 Å

PDB Description: human 20s proteasome complex with delanzomib at 2.0 angstrom
PDB Compounds: (E:) Proteasome subunit alpha type-1

SCOPe Domain Sequences for d5lf4e_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5lf4e_ d.153.1.0 (E:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
nqydndvtvwspqgrihqieyameavkqgsatvglkskthavlvalkraqselaahqkki
lhvdnhigisiagltadarllcnfmrqecldsrfvfdrplpvsrlvsligsktqiptqry
grrpygvglliagyddmgphifqtxpsanyfdcramsigarsqsartylerhmsefmecn
lnelvkhglralretlpaeqdlttknvsigivgkdleftiyddddvspflegle

SCOPe Domain Coordinates for d5lf4e_:

Click to download the PDB-style file with coordinates for d5lf4e_.
(The format of our PDB-style files is described here.)

Timeline for d5lf4e_: