Lineage for d1f5na2 (1f5n A:7-283)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2865683Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
    3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes
  4. 2865684Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (27 families) (S)
    division into families based on beta-sheet topologies
  5. 2866675Family c.37.1.8: G proteins [52592] (81 proteins)
    core: mixed beta-sheet of 6 strands, order 231456; strand 2 is antiparallel to the rest
  6. 2867301Protein Interferon-induced guanylate-binding protein 1 (GBP1), N-terminal domain [52639] (1 species)
  7. 2867302Species Human (Homo sapiens) [TaxId:9606] [52640] (2 PDB entries)
  8. 2867303Domain d1f5na2: 1f5n A:7-283 [32152]
    Other proteins in same PDB: d1f5na1
    complexed with gnp, mg
    has additional insertions and/or extensions that are not grouped together

Details for d1f5na2

PDB Entry: 1f5n (more details), 1.7 Å

PDB Description: human guanylate binding protein-1 in complex with the gtp analogue, gmppnp.
PDB Compounds: (A:) interferon-induced guanylate-binding protein 1

SCOPe Domain Sequences for d1f5na2:

Sequence, based on SEQRES records: (download)

>d1f5na2 c.37.1.8 (A:7-283) Interferon-induced guanylate-binding protein 1 (GBP1), N-terminal domain {Human (Homo sapiens) [TaxId: 9606]}
mtgpmclientngrlmanpealkilsaitqpmvvvaivglyrtgksylmnklagkkkgfs
lgstvqshtkgiwmwcvphpkkpghilvlldteglgdvekgdnqndswifalavllsstf
vynsigtinqqamdqlyyvtelthrirsksspdenenevedsadfvsffpdfvwtlrdfs
ldleadgqpltpdeyltyslklkkgtsqkdetfnlprlcirkffpkkkcfvfdrpvhrrk
laqleklqdeeldpefvqqvadfcsyifsnsktktls

Sequence, based on observed residues (ATOM records): (download)

>d1f5na2 c.37.1.8 (A:7-283) Interferon-induced guanylate-binding protein 1 (GBP1), N-terminal domain {Human (Homo sapiens) [TaxId: 9606]}
mtgpmclientngrlmanpealkilsaitqpmvvvaivglyrtgksylmnklagkkkgfs
lgstvqshtkgiwmwcvphpkkpghilvlldteglgdvekgdnqndswifalavllsstf
vynsigtinqqamdqlyyvtelthrirskssvedsadfvsffpdfvwtlrdfsldleadg
qpltpdeyltyslklkkgtsqkdetfnlprlcirkffpkkkcfvfdrpvhrrklaqlekl
qdeeldpefvqqvadfcsyifsnsktktls

SCOPe Domain Coordinates for d1f5na2:

Click to download the PDB-style file with coordinates for d1f5na2.
(The format of our PDB-style files is described here.)

Timeline for d1f5na2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1f5na1