Lineage for d1egaa1 (1ega A:4-182)

  1. Root: SCOPe 2.02
  2. 1143363Class c: Alpha and beta proteins (a/b) [51349] (147 folds)
  3. 1162955Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
    3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes
  4. 1162956Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (25 families) (S)
    division into families based on beta-sheet topologies
  5. 1163638Family c.37.1.8: G proteins [52592] (79 proteins)
    core: mixed beta-sheet of 6 strands, order 231456; strand 2 is antiparallel to the rest
  6. 1164015Protein GTPase Era, N-terminal domain [52637] (2 species)
  7. 1164016Species Escherichia coli [TaxId:562] [52638] (2 PDB entries)
  8. 1164017Domain d1egaa1: 1ega A:4-182 [32150]
    Other proteins in same PDB: d1egaa2, d1egab2
    complexed with so4

Details for d1egaa1

PDB Entry: 1ega (more details), 2.4 Å

PDB Description: crystal structure of a widely conserved gtpase era
PDB Compounds: (A:) protein (GTP-binding protein era)

SCOPe Domain Sequences for d1egaa1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1egaa1 c.37.1.8 (A:4-182) GTPase Era, N-terminal domain {Escherichia coli [TaxId: 562]}
dksycgfiaivgrpnvgkstllnkllgqkisitsrkaqttrhrivgihtegayqaiyvdt
pglhmeekrainrlmnkaasssigdvelvifvvegtrwtpddemvlnklregkapvilav
nkvdnvqekadllphlqflasqmnfldivpisaetglnvdtiaaivrkhlpeathhfpe

SCOPe Domain Coordinates for d1egaa1:

Click to download the PDB-style file with coordinates for d1egaa1.
(The format of our PDB-style files is described here.)

Timeline for d1egaa1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1egaa2