Lineage for d1egaa1 (1ega A:4-182)

  1. Root: SCOP 1.59
  2. 115903Class c: Alpha and beta proteins (a/b) [51349] (113 folds)
  3. 121667Fold c.37: P-loop containing nucleotide triphosphate hydrolases [52539] (1 superfamily)
  4. 121668Superfamily c.37.1: P-loop containing nucleotide triphosphate hydrolases [52540] (16 families) (S)
  5. 121912Family c.37.1.8: G proteins [52592] (23 proteins)
  6. 122046Protein GTPase Era, N-terminal domain [52637] (1 species)
  7. 122047Species Escherichia coli [TaxId:562] [52638] (1 PDB entry)
  8. 122048Domain d1egaa1: 1ega A:4-182 [32150]
    Other proteins in same PDB: d1egaa2, d1egab2

Details for d1egaa1

PDB Entry: 1ega (more details), 2.4 Å

PDB Description: crystal structure of a widely conserved gtpase era

SCOP Domain Sequences for d1egaa1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1egaa1 c.37.1.8 (A:4-182) GTPase Era, N-terminal domain {Escherichia coli}
dksycgfiaivgrpnvgkstllnkllgqkisitsrkaqttrhrivgihtegayqaiyvdt
pglhmeekrainrlmnkaasssigdvelvifvvegtrwtpddemvlnklregkapvilav
nkvdnvqekadllphlqflasqmnfldivpisaetglnvdtiaaivrkhlpeathhfpe

SCOP Domain Coordinates for d1egaa1:

Click to download the PDB-style file with coordinates for d1egaa1.
(The format of our PDB-style files is described here.)

Timeline for d1egaa1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1egaa2