Lineage for d5j2tb2 (5j2t B:246-438)

  1. Root: SCOPe 2.07
  2. 2530962Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2565345Fold d.79: Bacillus chorismate mutase-like [55297] (9 superfamilies)
    core: beta-alpha-beta-alpha-beta(2); mixed beta-sheet: order: 1423, strand 4 is antiparallel to the rest
  4. 2565735Superfamily d.79.2: Tubulin C-terminal domain-like [55307] (2 families) (S)
  5. 2565736Family d.79.2.1: Tubulin, C-terminal domain [55308] (4 proteins)
  6. 2565857Protein automated matches [227071] (7 species)
    not a true protein
  7. 2565863Species Cow (Bos taurus) [TaxId:9913] [226565] (145 PDB entries)
  8. 2566199Domain d5j2tb2: 5j2t B:246-438 [321482]
    Other proteins in same PDB: d5j2ta1, d5j2tb1, d5j2tc1, d5j2td1, d5j2te_, d5j2tf1, d5j2tf2, d5j2tf3
    automated match to d3rycd2
    complexed with ca, gdp, gtp, mes, mg, vlb

Details for d5j2tb2

PDB Entry: 5j2t (more details), 2.2 Å

PDB Description: tubulin-vinblastine complex
PDB Compounds: (B:) Tubulin beta-2B chain

SCOPe Domain Sequences for d5j2tb2:

Sequence; same for both SEQRES and ATOM records: (download)

>d5j2tb2 d.79.2.1 (B:246-438) automated matches {Cow (Bos taurus) [TaxId: 9913]}
gqlnadlrklavnmvpfprlhffmpgfapltsrgsqqyraltvpeltqqmfdsknmmaac
dprhgryltvaaifrgrmsmkevdeqmlnvqnknssyfvewipnnvktavcdipprglkm
satfignstaiqelfkriseqftamfrrkaflhwytgegmdemefteaesnmndlvseyq
qyqda

SCOPe Domain Coordinates for d5j2tb2:

Click to download the PDB-style file with coordinates for d5j2tb2.
(The format of our PDB-style files is described here.)

Timeline for d5j2tb2: