![]() | Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
![]() | Fold c.32: Tubulin nucleotide-binding domain-like [52489] (1 superfamily) 3 layers: a/b/a; parallel beta-sheet of 6 strands, order 321456 |
![]() | Superfamily c.32.1: Tubulin nucleotide-binding domain-like [52490] (2 families) ![]() automatically mapped to Pfam PF00091 |
![]() | Family c.32.1.1: Tubulin, GTPase domain [52491] (4 proteins) |
![]() | Protein automated matches [226837] (9 species) not a true protein |
![]() | Species Cow (Bos taurus) [TaxId:9913] [226564] (136 PDB entries) |
![]() | Domain d5j2tb1: 5j2t B:1-245 [321481] Other proteins in same PDB: d5j2ta2, d5j2tb2, d5j2tc2, d5j2td2, d5j2te_, d5j2tf1, d5j2tf2, d5j2tf3 automated match to d4drxb1 complexed with ca, gdp, gtp, mes, mg, vlb |
PDB Entry: 5j2t (more details), 2.2 Å
SCOPe Domain Sequences for d5j2tb1:
Sequence; same for both SEQRES and ATOM records: (download)
>d5j2tb1 c.32.1.1 (B:1-245) automated matches {Cow (Bos taurus) [TaxId: 9913]} mreivhiqagqcgnqigakfwevisdehgidptgsyhgdsdlqlerinvyyneatgnkyv prailvdlepgtmdsvrsgpfgqifrpdnfvfgqsgagnnwakghytegaelvdsvldvv rkesescdclqgfqlthslgggtgsgmgtlliskireeypdrimntfsvmpspkvsdtvv epynatlsvhqlventdetycidnealydicfrtlklttptygdlnhlvsatmsgvttcl rfp
Timeline for d5j2tb1: