Lineage for d1g7ta4 (1g7t A:1-227)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2109203Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
    3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes
  4. 2109204Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (26 families) (S)
    division into families based on beta-sheet topologies
  5. 2110099Family c.37.1.8: G proteins [52592] (79 protein domains)
    core: mixed beta-sheet of 6 strands, order 231456; strand 2 is antiparallel to the rest
  6. 2110566Protein Initiation factor IF2/eIF5b, N-terminal (G) domain [52635] (1 species)
  7. 2110567Species Methanobacterium thermoautotrophicum [TaxId:145262] [52636] (3 PDB entries)
  8. 2110569Domain d1g7ta4: 1g7t A:1-227 [32148]
    Other proteins in same PDB: d1g7ta1, d1g7ta2, d1g7ta3
    complexed with gnp, mg

Details for d1g7ta4

PDB Entry: 1g7t (more details), 2 Å

PDB Description: x-ray structure of translation initiation factor if2/eif5b complexed with gdpnp
PDB Compounds: (A:) translation initiation factor if2/eif5b

SCOPe Domain Sequences for d1g7ta4:

Sequence, based on SEQRES records: (download)

>d1g7ta4 c.37.1.8 (A:1-227) Initiation factor IF2/eIF5b, N-terminal (G) domain {Methanobacterium thermoautotrophicum [TaxId: 145262]}
mkirspivsvlghvdhgkttlldhirgsavasreaggitqhigateipmdviegicgdfl
kkfsiretlpglffidtpgheafttlrkrggaladlailivdinegfkpqtqealnilrm
yrtpfvvaankidrihgwrvhegrpfmetfskqdiqvqqkldtkvyelvgklheegfese
rfdrvtdfasqvsiipisaitgegipelltmlmglaqqylreqlkie

Sequence, based on observed residues (ATOM records): (download)

>d1g7ta4 c.37.1.8 (A:1-227) Initiation factor IF2/eIF5b, N-terminal (G) domain {Methanobacterium thermoautotrophicum [TaxId: 145262]}
mkirspivsvlghvdhgkttlldhirgsavasritqhigateipmdviegicgdflkkfs
iretlpglffidtpgheafttlrkrggaladlailivdinegfkpqtqealnilrmyrtp
fvvaankidrihgwrvhegrpfmetfskqdiqvqqkldtkvyelvgklheegfeserfdr
vtdfasqvsiipisaitgegipelltmlmglaqqylreqlkie

SCOPe Domain Coordinates for d1g7ta4:

Click to download the PDB-style file with coordinates for d1g7ta4.
(The format of our PDB-style files is described here.)

Timeline for d1g7ta4: