![]() | Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
![]() | Fold c.30: PreATP-grasp domain [52439] (1 superfamily) 3 layers: a/b/a; parallel or mixed beta-sheet of 4 to 6 strands possible rudiment form of Rossmann-fold domain |
![]() | Superfamily c.30.1: PreATP-grasp domain [52440] (10 families) ![]() precedes the ATP-grasp domain common to all superfamily members, can contain a substrate-binding function |
![]() | Family c.30.1.9: Tubulin tyrosine ligase (TTL) N-terminal domain-like [310625] (1 protein) |
![]() | Protein Tubulin tyrosine ligase (TTL) N-terminal domain [310727] (2 species) |
![]() | Species Chicken (Gallus gallus) [TaxId:9031] [311384] (77 PDB entries) |
![]() | Domain d5j2tf1: 5j2t F:1-76 [321476] Other proteins in same PDB: d5j2ta1, d5j2ta2, d5j2tb1, d5j2tb2, d5j2tc1, d5j2tc2, d5j2td1, d5j2td2, d5j2te_, d5j2tf2, d5j2tf3 automated match to d3tiia1 complexed with ca, gdp, gtp, mes, mg, vlb |
PDB Entry: 5j2t (more details), 2.2 Å
SCOPe Domain Sequences for d5j2tf1:
Sequence; same for both SEQRES and ATOM records: (download)
>d5j2tf1 c.30.1.9 (F:1-76) Tubulin tyrosine ligase (TTL) N-terminal domain {Chicken (Gallus gallus) [TaxId: 9031]} mytfvvrdenssvyaevsrlllatgqwkrlrkdnprfnlmlgernrlpfgrlghepglvq lvnyyrgadklcrkas
Timeline for d5j2tf1: