Lineage for d1g7sa4 (1g7s A:1-227)

  1. Root: SCOPe 2.07
  2. 2413226Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2446887Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
    3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes
  4. 2446888Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (26 families) (S)
    division into families based on beta-sheet topologies
  5. 2447791Family c.37.1.8: G proteins [52592] (80 protein domains)
    core: mixed beta-sheet of 6 strands, order 231456; strand 2 is antiparallel to the rest
  6. 2448271Protein Initiation factor IF2/eIF5b, N-terminal (G) domain [52635] (1 species)
  7. 2448272Species Methanobacterium thermoautotrophicum [TaxId:145262] [52636] (3 PDB entries)
  8. 2448273Domain d1g7sa4: 1g7s A:1-227 [32147]
    Other proteins in same PDB: d1g7sa1, d1g7sa2, d1g7sa3
    complexed with gdp

Details for d1g7sa4

PDB Entry: 1g7s (more details), 2 Å

PDB Description: x-ray structure of translation initiation factor if2/eif5b complexed with gdp
PDB Compounds: (A:) translation initiation factor if2/eif5b

SCOPe Domain Sequences for d1g7sa4:

Sequence, based on SEQRES records: (download)

>d1g7sa4 c.37.1.8 (A:1-227) Initiation factor IF2/eIF5b, N-terminal (G) domain {Methanobacterium thermoautotrophicum [TaxId: 145262]}
mkirspivsvlghvdhgkttlldhirgsavasreaggitqhigateipmdviegicgdfl
kkfsiretlpglffidtpgheafttlrkrggaladlailivdinegfkpqtqealnilrm
yrtpfvvaankidrihgwrvhegrpfmetfskqdiqvqqkldtkvyelvgklheegfese
rfdrvtdfasqvsiipisaitgegipelltmlmglaqqylreqlkie

Sequence, based on observed residues (ATOM records): (download)

>d1g7sa4 c.37.1.8 (A:1-227) Initiation factor IF2/eIF5b, N-terminal (G) domain {Methanobacterium thermoautotrophicum [TaxId: 145262]}
mkirspivsvlghvdhgkttlldhirgsavasritqhigateipmdviegicgdflkkfs
iretlpglffidtpgheafttlrkrggaladlailivdinegfkpqtqealnilrmyrtp
fvvaankidrihgwrvhegrpfmetfskqdiqvqqkldtkvyelvgklheegfeserfdr
vtdfasqvsiipisaitgegipelltmlmglaqqylreqlkie

SCOPe Domain Coordinates for d1g7sa4:

Click to download the PDB-style file with coordinates for d1g7sa4.
(The format of our PDB-style files is described here.)

Timeline for d1g7sa4: