Lineage for d1efga2 (1efg A:1-282)

  1. Root: SCOPe 2.07
  2. 2434694Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2473887Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
    3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes
  4. 2473888Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (26 families) (S)
    division into families based on beta-sheet topologies
  5. 2474875Family c.37.1.8: G proteins [52592] (80 proteins)
    core: mixed beta-sheet of 6 strands, order 231456; strand 2 is antiparallel to the rest
  6. 2475315Protein Elongation factor G (EF-G), N-terminal (G) domain [52633] (2 species)
    has internal nucleotide exchange factor built in as an insertion subdomain
  7. 2475316Species Thermus thermophilus [TaxId:274] [52634] (9 PDB entries)
    residues 160-252 comprise insertion subdomain
  8. 2475324Domain d1efga2: 1efg A:1-282 [32146]
    Other proteins in same PDB: d1efga1, d1efga3, d1efga4
    complexed with gdp

Details for d1efga2

PDB Entry: 1efg (more details), 2.7 Å

PDB Description: the crystal structure of elongation factor g complexed with gdp, at 2.7 angstroms resolution
PDB Compounds: (A:) Elongation factor G

SCOPe Domain Sequences for d1efga2:

Sequence, based on SEQRES records: (download)

>d1efga2 c.37.1.8 (A:1-282) Elongation factor G (EF-G), N-terminal (G) domain {Thermus thermophilus [TaxId: 274]}
mavkveydlkrlrnigiaahidagktttterilyytgrihkigevhegaatmdfmeqere
rgititaavttcfwkdhriniidtpghvdftieversmrvldgaivvfdssqgvepqset
vwrqaekykvpriafankmdktgadlwlvirtmqerlgarpvvmqlpigredtfsgiidv
lrmkaytygndlgtdireipipeeyldnareyheklvevaadfdenimlkylegeeptee
elvaairkgtidlkitpvflgsalknkgvqllldavvdylps

Sequence, based on observed residues (ATOM records): (download)

>d1efga2 c.37.1.8 (A:1-282) Elongation factor G (EF-G), N-terminal (G) domain {Thermus thermophilus [TaxId: 274]}
mavkveydlkrlrnigiaahidagktttterilyytgrihktaavttcfwkdhriniidt
pghvdftieversmrvldgaivvfdssqgvepqsetvwrqaekykvpriafankmdktga
dlwlvirtmqerlgarpvvmqlpigredtfsgiidvlrmkaytygndlgtdireipipee
yldnareyheklvevaadfdenimlkylegeepteeelvaairkgtidlkitpvflgsal
knkgvqllldavvdylps

SCOPe Domain Coordinates for d1efga2:

Click to download the PDB-style file with coordinates for d1efga2.
(The format of our PDB-style files is described here.)

Timeline for d1efga2: