Lineage for d5kr7b_ (5kr7 B:)

  1. Root: SCOPe 2.07
  2. 2344607Class b: All beta proteins [48724] (178 folds)
  3. 2403751Fold b.82: Double-stranded beta-helix [51181] (7 superfamilies)
    one turn of helix is made by two pairs of antiparallel strands linked with short turns
    has appearance of a sandwich of distinct architecture and jelly-roll topology
  4. 2404605Superfamily b.82.2: Clavaminate synthase-like [51197] (16 families) (S)
    Iron and ketoglutarate-dependent enzymes; elaborated version of this common fold
  5. 2404954Family b.82.2.14: Histone demethylase core [254153] (4 protein domains)
    Jumonji domain; Pfam PF02375 (JmjN) and Pfam PF02373 (JmjC); relationship to FIH1 (b.82.2.6) described in PubMed 16983801
  6. 2405080Protein automated matches [254635] (1 species)
    not a true protein
  7. 2405081Species Human (Homo sapiens) [TaxId:9606] [255633] (263 PDB entries)
  8. 2405332Domain d5kr7b_: 5kr7 B: [321451]
    automated match to d5f37b_
    complexed with 6x9, cl, fe2, zn

Details for d5kr7b_

PDB Entry: 5kr7 (more details), 1.9 Å

PDB Description: kdm4c bound to pyrazolo-pyrimidine scaffold
PDB Compounds: (B:) lysine-specific demethylase 4c

SCOPe Domain Sequences for d5kr7b_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5kr7b_ b.82.2.14 (B:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
lnpsckimtfrpsmeefrefnkylaymeskgahraglakvippkewkprqcyddidnlli
papiqqmvtgqsglftqyniqkkamtvkefrqlansgkyctpryldyedlerkywknltf
vapiygadingsiydegvdewniarlntvldvveeecgisiegvntpylyfgmwkttfaw
htedmdlysinylhfgepkswyaippehgkrlerlaqgffpsssqgcdaflrhkmtlisp
svlkkygipfdkitqeagefmitfpygyhagfnhgfncaestnfatvrwidygkvaklct
crkdmvkismdifvrkfqpdryqlwkqgkdiytidhtkp

SCOPe Domain Coordinates for d5kr7b_:

Click to download the PDB-style file with coordinates for d5kr7b_.
(The format of our PDB-style files is described here.)

Timeline for d5kr7b_: