Lineage for d1elo_2 (1elo 5-282)

  1. Root: SCOP 1.67
  2. 383641Class c: Alpha and beta proteins (a/b) [51349] (130 folds)
  3. 393331Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
    3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes
  4. 393332Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (22 families) (S)
    division into families based on beta-sheet topologies
  5. 393753Family c.37.1.8: G proteins [52592] (37 proteins)
    core: mixed beta-sheet of 6 strands, order 231456; strand 2 is antiparallel to the rest
  6. 393902Protein Elongation factor G (EF-G), N-terminal (G) domain [52633] (1 species)
    has internal nucleotide exchange factor built in as an insertion subdomain
  7. 393903Species Thermus thermophilus [TaxId:274] [52634] (6 PDB entries)
    residues 160-252 comprise insertion subdomain
  8. 393907Domain d1elo_2: 1elo 5-282 [32145]
    Other proteins in same PDB: d1elo_1, d1elo_3, d1elo_4

Details for d1elo_2

PDB Entry: 1elo (more details), 2.85 Å

PDB Description: elongation factor g without nucleotide

SCOP Domain Sequences for d1elo_2:

Sequence, based on SEQRES records: (download)

>d1elo_2 c.37.1.8 (5-282) Elongation factor G (EF-G), N-terminal (G) domain {Thermus thermophilus}
veydlkrlrnigiaahidagktttterilyytgrihkigevhegaatmdfmeqerergit
itaavttcfwkdhriniidtpghvdftieversmrvldgaivvfdssqgvepqsetvwrq
aekykvpriafankmdktgadlwlvirtmqerlgarpvvmqlpigredtfsgiidvlrmk
aytygndlgtdireipipeeyldqareyheklvevaadfdenimlkylegeepteeelva
airkgtidlkitpvflgsalknkgvqllldavvdylps

Sequence, based on observed residues (ATOM records): (download)

>d1elo_2 c.37.1.8 (5-282) Elongation factor G (EF-G), N-terminal (G) domain {Thermus thermophilus}
veydlkrlrnigiaahidagktttterilyytgriavttcfwkdhriniidtpghvdfti
eversmrvldgaivvfdssqgvepqsetvwrqaekykvpriafankmdktgadlwlvirt
mqerlgarpvvmqlpigredtfsgiidvlrmkaytygndlgtdireipipeeyldqarey
heklvevaadfdenimlkylegeepteeelvaairkgtidlkitpvflgsalknkgvqll
ldavvdylps

SCOP Domain Coordinates for d1elo_2:

Click to download the PDB-style file with coordinates for d1elo_2.
(The format of our PDB-style files is described here.)

Timeline for d1elo_2: