Lineage for d1elo_2 (1elo 5-282)

  1. Root: SCOP 1.55
  2. 18352Class c: Alpha and beta proteins (a/b) [51349] (97 folds)
  3. 22942Fold c.37: P-loop containing nucleotide triphosphate hydrolases [52539] (1 superfamily)
  4. 22943Superfamily c.37.1: P-loop containing nucleotide triphosphate hydrolases [52540] (14 families) (S)
  5. 23121Family c.37.1.8: G proteins [52592] (20 proteins)
  6. 23196Protein Elongation factor G (EF-G), N-terminal (G) domain [52633] (1 species)
  7. 23197Species Thermus thermophilus [TaxId:274] [52634] (5 PDB entries)
  8. 23201Domain d1elo_2: 1elo 5-282 [32145]
    Other proteins in same PDB: d1elo_1, d1elo_3, d1elo_4

Details for d1elo_2

PDB Entry: 1elo (more details), 2.85 Å

PDB Description: elongation factor g without nucleotide
PDB Compounds: ( :)

SCOP Domain Sequences for d1elo_2:

Sequence, based on SEQRES records: (download)

>d1elo_2 c.37.1.8 (5-282) Elongation factor G (EF-G), N-terminal (G) domain {Thermus thermophilus}
veydlkrlrnigiaahidagktttterilyytgrihkigevhegaatmdfmeqerergit
itaavttcfwkdhriniidtpghvdftieversmrvldgaivvfdssqgvepqsetvwrq
aekykvpriafankmdktgadlwlvirtmqerlgarpvvmqlpigredtfsgiidvlrmk
aytygndlgtdireipipeeyldqareyheklvevaadfdenimlkylegeepteeelva
airkgtidlkitpvflgsalknkgvqllldavvdylps

Sequence, based on observed residues (ATOM records): (download)

>d1elo_2 c.37.1.8 (5-282) Elongation factor G (EF-G), N-terminal (G) domain {Thermus thermophilus}
veydlkrlrnigiaahidagktttterilyytgriavttcfwkdhriniidtpghvdfti
eversmrvldgaivvfdssqgvepqsetvwrqaekykvpriafankmdktgadlwlvirt
mqerlgarpvvmqlpigredtfsgiidvlrmkaytygndlgtdireipipeeyldqarey
heklvevaadfdenimlkylegeepteeelvaairkgtidlkitpvflgsalknkgvqll
ldavvdylps

SCOP Domain Coordinates for d1elo_2:

Click to download the PDB-style file with coordinates for d1elo_2.
(The format of our PDB-style files is described here.)

Timeline for d1elo_2: