Lineage for d5j7cc1 (5j7c C:4-94)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2739517Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2761681Superfamily b.1.2: Fibronectin type III [49265] (2 families) (S)
  5. 2762239Family b.1.2.0: automated matches [191562] (1 protein)
    not a true family
  6. 2762240Protein automated matches [190976] (5 species)
    not a true protein
  7. 2762264Species Human (Homo sapiens) [TaxId:9606] [188649] (69 PDB entries)
  8. 2762338Domain d5j7cc1: 5j7c C:4-94 [321443]
    Other proteins in same PDB: d5j7ca_, d5j7cb_, d5j7cc2, d5j7cd2
    automated match to d5a41g_

Details for d5j7cc1

PDB Entry: 5j7c (more details), 2.54 Å

PDB Description: a picomolar affinity fn3 domain in complex with hen egg-white lysozyme
PDB Compounds: (C:) FNfn10-anti-lysozyme (DE0.4.1)

SCOPe Domain Sequences for d5j7cc1:

Sequence; same for both SEQRES and ATOM records: (download)

>d5j7cc1 b.1.2.0 (C:4-94) automated matches {Human (Homo sapiens) [TaxId: 9606]}
dvprdlevvaatptslliswrgypwatyygiiygetggnslvqeftmpgdlshratisgl
kpgvdytitvyavtrvgrtfdtpgpisinyr

SCOPe Domain Coordinates for d5j7cc1:

Click to download the PDB-style file with coordinates for d5j7cc1.
(The format of our PDB-style files is described here.)

Timeline for d5j7cc1: