Lineage for d5in5d1 (5in5 D:23-372)
- Root: SCOPe 2.07
Class c: Alpha and beta proteins (a/b) [51349] (148 folds) 
Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily)
core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456
The nucleotide-binding modes of this and the next two folds/superfamilies are similarSuperfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (13 families) 
Family c.2.1.2: Tyrosine-dependent oxidoreductases [51751] (71 proteins)
also known as short-chain dehydrogenases and SDR family
parallel beta-sheet is extended by 7th strand, order 3214567; left-handed crossover connection between strands 6 and 7
Protein GDP-mannose 4,6-dehydratase [51759] (4 species) 
Species Human (Homo sapiens) [TaxId:9606] [102135] (7 PDB entries) 
Domain d5in5d1: 5in5 D:23-372 [321436]
Other proteins in same PDB: d5in5a2, d5in5b2, d5in5c2, d5in5d2
automated match to d1t2aa_
complexed with gdp, gfb, gol, nap
Details for d5in5d1
PDB Entry: 5in5 (more details), 1.9 Å
PDB Description: crystal structure of gdp-mannose 4,6 dehydratase in complex with natural inhibitor gdp-fucose
PDB Compounds: (D:) GDP-mannose 4,6 dehydrataseSCOPe Domain Sequences for d5in5d1:
Sequence; same for both SEQRES and ATOM records: (download)
>d5in5d1 c.2.1.2 (D:23-372) GDP-mannose 4,6-dehydratase {Human (Homo sapiens) [TaxId: 9606]}
rnvalitgitgqdgsylaefllekgyevhgivrrsssfntgriehlyknpqahiegnmkl
hygdltdstclvkiinevkpteiynlgaqshvkisfdlaeytadvdgvgtlrlldavktc
glinsvkfyqastselygkvqeipqkettpfyprspygaaklyaywivvnfreaynlfav
ngilfnhesprrganfvtrkisrsvakiylgqlecfslgnldakrdwghakdyveamwlm
lqndepedfviatgevhsvrefveksflhigktivwegknenevgrcketgkvhvtvdlk
yyrptevdflqgdctkakqklnwkprvafdelvremvhadvelmrtnpna
SCOPe Domain Coordinates for d5in5d1:
Click to download the PDB-style file with coordinates for d5in5d1.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d5in5d1:
View in 3D
