![]() | Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
![]() | Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily) core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456 The nucleotide-binding modes of this and the next two folds/superfamilies are similar |
![]() | Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (13 families) ![]() |
![]() | Family c.2.1.2: Tyrosine-dependent oxidoreductases [51751] (73 proteins) also known as short-chain dehydrogenases and SDR family parallel beta-sheet is extended by 7th strand, order 3214567; left-handed crossover connection between strands 6 and 7 has additional subdomain(s) that are not in the common domain |
![]() | Protein GDP-mannose 4,6-dehydratase [51759] (4 species) |
![]() | Species Human (Homo sapiens) [TaxId:9606] [102135] (7 PDB entries) |
![]() | Domain d5in5d1: 5in5 D:23-372 [321436] Other proteins in same PDB: d5in5a2, d5in5b2, d5in5c2, d5in5d2 automated match to d1t2aa_ complexed with gdp, gfb, gol, nap has additional subdomain(s) that are not in the common domain |
PDB Entry: 5in5 (more details), 1.9 Å
SCOPe Domain Sequences for d5in5d1:
Sequence; same for both SEQRES and ATOM records: (download)
>d5in5d1 c.2.1.2 (D:23-372) GDP-mannose 4,6-dehydratase {Human (Homo sapiens) [TaxId: 9606]} rnvalitgitgqdgsylaefllekgyevhgivrrsssfntgriehlyknpqahiegnmkl hygdltdstclvkiinevkpteiynlgaqshvkisfdlaeytadvdgvgtlrlldavktc glinsvkfyqastselygkvqeipqkettpfyprspygaaklyaywivvnfreaynlfav ngilfnhesprrganfvtrkisrsvakiylgqlecfslgnldakrdwghakdyveamwlm lqndepedfviatgevhsvrefveksflhigktivwegknenevgrcketgkvhvtvdlk yyrptevdflqgdctkakqklnwkprvafdelvremvhadvelmrtnpna
Timeline for d5in5d1: