Lineage for d5j2ud1 (5j2u D:2-245)
- Root: SCOPe 2.07
Class c: Alpha and beta proteins (a/b) [51349] (148 folds) 
Fold c.32: Tubulin nucleotide-binding domain-like [52489] (1 superfamily)
3 layers: a/b/a; parallel beta-sheet of 6 strands, order 321456Superfamily c.32.1: Tubulin nucleotide-binding domain-like [52490] (2 families) 
automatically mapped to Pfam PF00091Family c.32.1.1: Tubulin, GTPase domain [52491] (4 proteins) 
Protein automated matches [226837] (10 species)
not a true protein
Species Cow (Bos taurus) [TaxId:9913] [226564] (128 PDB entries) 
Domain d5j2ud1: 5j2u D:2-245 [321431]
Other proteins in same PDB: d5j2ua2, d5j2ub2, d5j2uc2, d5j2ud2, d5j2ue_, d5j2uf1, d5j2uf2
automated match to d4drxb1
complexed with 6do, acp, ca, gdp, gtp, mg
Details for d5j2ud1
PDB Entry: 5j2u (more details), 2.5 Å
PDB Description: tubulin-mmaf complex
PDB Compounds: (D:) Tubulin beta-2B chainSCOPe Domain Sequences for d5j2ud1:
Sequence; same for both SEQRES and ATOM records: (download)
>d5j2ud1 c.32.1.1 (D:2-245) automated matches {Cow (Bos taurus) [TaxId: 9913]}
reivhiqagqcgnqigakfwevisdehgidptgsyhgdsdlqlerinvyyneatgnkyvp
railvdlepgtmdsvrsgpfgqifrpdnfvfgqsgagnnwakghytegaelvdsvldvvr
kesescdclqgfqlthslgggtgsgmgtlliskireeypdrimntfsvmpspkvsdtvve
pynatlsvhqlventdetycidnealydicfrtlklttptygdlnhlvsatmsgvttclr
fp
SCOPe Domain Coordinates for d5j2ud1:
Click to download the PDB-style file with coordinates for d5j2ud1.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d5j2ud1:
View in 3D
