Lineage for d1dar_2 (1dar 1-282)

  1. Root: SCOP 1.69
  2. 473232Class c: Alpha and beta proteins (a/b) [51349] (136 folds)
  3. 483669Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
    3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes
  4. 483670Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (22 families) (S)
    division into families based on beta-sheet topologies
  5. 484126Family c.37.1.8: G proteins [52592] (43 proteins)
    core: mixed beta-sheet of 6 strands, order 231456; strand 2 is antiparallel to the rest
  6. 484278Protein Elongation factor G (EF-G), N-terminal (G) domain [52633] (1 species)
    has internal nucleotide exchange factor built in as an insertion subdomain
  7. 484279Species Thermus thermophilus [TaxId:274] [52634] (6 PDB entries)
    residues 160-252 comprise insertion subdomain
  8. 484280Domain d1dar_2: 1dar 1-282 [32142]
    Other proteins in same PDB: d1dar_1, d1dar_3, d1dar_4

Details for d1dar_2

PDB Entry: 1dar (more details), 2.4 Å

PDB Description: elongation factor g in complex with gdp

SCOP Domain Sequences for d1dar_2:

Sequence, based on SEQRES records: (download)

>d1dar_2 c.37.1.8 (1-282) Elongation factor G (EF-G), N-terminal (G) domain {Thermus thermophilus}
mavkveydlkrlrnigiaahidagktttterilyytgrihkigevhegaatmdfmeqere
rgititaavttcfwkdhriniidtpghvdftieversmrvldgaivvfdssqgvepqset
vwrqaekykvpriafankmdktgadlwlvirtmqerlgarpvvmqlpigredtfsgiidv
lrmkaytygndlgtdireipipeeyldqareyheklvevaadfdenimlkylegeeptee
elvaairkgtidlkitpvflgsalknkgvqllldavvdylps

Sequence, based on observed residues (ATOM records): (download)

>d1dar_2 c.37.1.8 (1-282) Elongation factor G (EF-G), N-terminal (G) domain {Thermus thermophilus}
mavkveydlkrlrnigiaahidagktttterilyytgriaavttcfwkdhriniidtpgh
vdftieversmrvldgaivvfdssqgvepqsetvwrqaekykvpriafankmdktgadlw
lvirtmqerlgarpvvmqlpigredtfsgiidvlrmkaytygndlgtdireipipeeyld
qareyheklvevaadfdenimlkylegeepteeelvaairkgtidlkitpvflgsalknk
gvqllldavvdylps

SCOP Domain Coordinates for d1dar_2:

Click to download the PDB-style file with coordinates for d1dar_2.
(The format of our PDB-style files is described here.)

Timeline for d1dar_2: