Lineage for d5j2ta2 (5j2t A:246-439)
- Root: SCOPe 2.07
Class d: Alpha and beta proteins (a+b) [53931] (388 folds) 
Fold d.79: Bacillus chorismate mutase-like [55297] (9 superfamilies)
core: beta-alpha-beta-alpha-beta(2); mixed beta-sheet: order: 1423, strand 4 is antiparallel to the rest
Superfamily d.79.2: Tubulin C-terminal domain-like [55307] (2 families) 
Family d.79.2.1: Tubulin, C-terminal domain [55308] (4 proteins) 
Protein automated matches [227071] (7 species)
not a true protein
Species Cow (Bos taurus) [TaxId:9913] [226565] (145 PDB entries) 
Domain d5j2ta2: 5j2t A:246-439 [321419]
Other proteins in same PDB: d5j2ta1, d5j2tb1, d5j2tc1, d5j2td1, d5j2te_, d5j2tf1, d5j2tf2, d5j2tf3
automated match to d4i50a2
complexed with ca, gdp, gtp, mes, mg, vlb
Details for d5j2ta2
PDB Entry: 5j2t (more details), 2.2 Å
PDB Description: tubulin-vinblastine complex
PDB Compounds: (A:) Tubulin alpha-1B chainSCOPe Domain Sequences for d5j2ta2:
Sequence; same for both SEQRES and ATOM records: (download)
>d5j2ta2 d.79.2.1 (A:246-439) automated matches {Cow (Bos taurus) [TaxId: 9913]}
galnvdltefqtnlvpyprihfplatyapvisaekayheqlsvaeitnacfepanqmvkc
dprhgkymaccllyrgdvvpkdvnaaiatiktkrsiqfvdwcptgfkvginyqpptvvpg
gdlakvqravcmlsnttaiaeawarldhkfdlmyakrafvhwyvgegmeegefsearedm
aalekdyeevgvds
SCOPe Domain Coordinates for d5j2ta2:
Click to download the PDB-style file with coordinates for d5j2ta2.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d5j2ta2:
View in 3D
