Lineage for d5iyza2 (5iyz A:246-437)

  1. Root: SCOPe 2.06
  2. 2170735Class d: Alpha and beta proteins (a+b) [53931] (385 folds)
  3. 2201108Fold d.79: Bacillus chorismate mutase-like [55297] (9 superfamilies)
    core: beta-alpha-beta-alpha-beta(2); mixed beta-sheet: order: 1423, strand 4 is antiparallel to the rest
  4. 2201404Superfamily d.79.2: Tubulin C-terminal domain-like [55307] (2 families) (S)
  5. 2201405Family d.79.2.1: Tubulin, C-terminal domain [55308] (4 proteins)
  6. 2201524Protein automated matches [227071] (5 species)
    not a true protein
  7. 2201530Species Cow (Bos taurus) [TaxId:9913] [226565] (48 PDB entries)
  8. 2201551Domain d5iyza2: 5iyz A:246-437 [321416]
    Other proteins in same PDB: d5iyza1, d5iyzb1, d5iyzc1, d5iyzd1, d5iyze_, d5iyzf1, d5iyzf2, d5iyzf3
    automated match to d4i50a2
    complexed with 4q5, acp, ca, gdp, gtp, mes, mg

Details for d5iyza2

PDB Entry: 5iyz (more details), 1.8 Å

PDB Description: tubulin-mmae complex
PDB Compounds: (A:) Tubulin alpha-1B chain

SCOPe Domain Sequences for d5iyza2:

Sequence; same for both SEQRES and ATOM records: (download)

>d5iyza2 d.79.2.1 (A:246-437) automated matches {Cow (Bos taurus) [TaxId: 9913]}
galnvdltefqtnlvpyprihfplatyapvisaekayheqlsvaeitnacfepanqmvkc
dprhgkymaccllyrgdvvpkdvnaaiatiktkrsiqfvdwcptgfkvginyqpptvvpg
gdlakvqravcmlsnttaiaeawarldhkfdlmyakrafvhwyvgegmeegefsearedm
aalekdyeevgv

SCOPe Domain Coordinates for d5iyza2:

Click to download the PDB-style file with coordinates for d5iyza2.
(The format of our PDB-style files is described here.)

Timeline for d5iyza2: