Lineage for d1g7ca3 (1g7c A:4-240)

  1. Root: SCOPe 2.06
  2. 2089713Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2123292Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
    3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes
  4. 2123293Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (26 families) (S)
    division into families based on beta-sheet topologies
  5. 2124192Family c.37.1.8: G proteins [52592] (79 proteins)
    core: mixed beta-sheet of 6 strands, order 231456; strand 2 is antiparallel to the rest
  6. 2124522Protein Elongation factor eEF-1alpha, N-terminal (G) domain [52631] (2 species)
    eukaryotic and archaeal homologue of EF-Tu
  7. 2124523Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [52632] (6 PDB entries)
  8. 2124526Domain d1g7ca3: 1g7c A:4-240 [32141]
    Other proteins in same PDB: d1g7ca1, d1g7ca2, d1g7cb_
    complexed with 5gp

Details for d1g7ca3

PDB Entry: 1g7c (more details), 2.05 Å

PDB Description: yeast eef1a:eef1ba in complex with gdpnp
PDB Compounds: (A:) Elongation factor 1-alpha

SCOPe Domain Sequences for d1g7ca3:

Sequence; same for both SEQRES and ATOM records: (download)

>d1g7ca3 c.37.1.8 (A:4-240) Elongation factor eEF-1alpha, N-terminal (G) domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
ekshinvvvighvdsgkstttghliykcggidkrtiekfekeaaelgkgsfkyawvldkl
kaerergitidialwkfetpkyqvtvidapghrdfiknmitgtsqadcailiiaggvgef
eagiskdgqtrehallaftlgvrqlivavnkmdsvkwdesrfqeivketsnfikkvgynp
ktvpfvpisgwngdnmieattnapwykgweketkagvvkgktlleaidaieqpsrpt

SCOPe Domain Coordinates for d1g7ca3:

Click to download the PDB-style file with coordinates for d1g7ca3.
(The format of our PDB-style files is described here.)

Timeline for d1g7ca3:

View in 3D
Domains from other chains:
(mouse over for more information)
d1g7cb_