SCOPe 2.08: Domain d5irca1: 5irc A:1242-1439

Lineage for d5irca1 (5irc A:1242-1439)

1. Root: SCOPe 2.08

2. Class a: All alpha proteins [46456] (290 folds)

3. Fold a.116: GTPase activation domain, GAP [48349] (1 superfamily)
   multihelical

4. Superfamily a.116.1: GTPase activation domain, GAP [48350] (3 families)

5. Family a.116.1.0: automated matches [227202] (1 protein)
   not a true family

6. Protein automated matches [226932] (4 species)
   not a true protein

7. Species Norway rat (Rattus norvegicus) [TaxId:10116] [321372] (1 PDB entry)

8. Domain d5irca1: 5irc A:1242-1439 [321402]
   Other proteins in same PDB: d5irca2, d5ircd_, d5ircf_
   automated match to d3fk2a_
   complexed with cl, gdp, mg, mgf

Details for d5irca1

PDB Entry: 5irc, 1.72 Å

PDB Description: p190a gap domain complex with rhoa

PDB Compounds: (A:) Rho GTPase-activating protein 35

SCOPe Domain Sequences for d5irca1:

Sequence; same for both SEQRES and ATOM records:

>d5irca1 a.116.1.0 (A:1242-1439) automated matches {Norway rat (Rattus norvegicus) [TaxId: 10116]}
wesnyfgvplttvvtpekpipifiercieyieatglstegiyrvsgnksemeslqrqfdq
dhnldlaekdftvntvagamksffselpdplvpysmqidlveahkindreqklhalkevl
kkfpkenhevfkyvishlnrvshnnkvnlmtsenlsicfwptlmrpdfssmdaltatrsy
qtiielfiqqcpfffynr

Timeline for d5irca1:

• d5irca1 first appeared in SCOPe 2.06
  
• d5irca1 appears in SCOPe 2.07