Lineage for d1f60a3 (1f60 A:2-240)

  1. Root: SCOP 1.73
  2. 681097Class c: Alpha and beta proteins (a/b) [51349] (141 folds)
  3. 695085Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
    3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes
  4. 695086Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (24 families) (S)
    division into families based on beta-sheet topologies
  5. 695634Family c.37.1.8: G proteins [52592] (78 proteins)
    core: mixed beta-sheet of 6 strands, order 231456; strand 2 is antiparallel to the rest
  6. 695845Protein Elongation factor eEF-1alpha, N-terminal (G) domain [52631] (2 species)
    eukaryotic and archaeal homologue of EF-Tu
  7. 695851Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [52632] (6 PDB entries)
  8. 695852Domain d1f60a3: 1f60 A:2-240 [32140]
    Other proteins in same PDB: d1f60a1, d1f60a2, d1f60b_

Details for d1f60a3

PDB Entry: 1f60 (more details), 1.67 Å

PDB Description: crystal structure of the yeast elongation factor complex eef1a:eef1ba
PDB Compounds: (A:) elongation factor eef1a

SCOP Domain Sequences for d1f60a3:

Sequence; same for both SEQRES and ATOM records: (download)

>d1f60a3 c.37.1.8 (A:2-240) Elongation factor eEF-1alpha, N-terminal (G) domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
gkekshinvvvighvdsgkstttghliykcggidkrtiekfekeaaelgkgsfkyawvld
klkaerergitidialwkfetpkyqvtvidapghrdfiknmitgtsqadcailiiaggvg
efeagiskdgqtrehallaftlgvrqlivavnkmdsvkwdesrfqeivketsnfikkvgy
npktvpfvpisgwngdnmieattnapwykgweketkagvvkgktlleaidaieqpsrpt

SCOP Domain Coordinates for d1f60a3:

Click to download the PDB-style file with coordinates for d1f60a3.
(The format of our PDB-style files is described here.)

Timeline for d1f60a3:

View in 3D
Domains from other chains:
(mouse over for more information)
d1f60b_