SCOP 1.57: Domain d1f60a3: 1f60 A:2-240

Lineage for d1f60a3 (1f60 A:2-240)

1. Root: SCOP 1.57

2. Class c: Alpha and beta proteins (a/b) [51349] (107 folds)

3. Fold c.37: P-loop containing nucleotide triphosphate hydrolases [52539] (1 superfamily)

4. Superfamily c.37.1: P-loop containing nucleotide triphosphate hydrolases [52540] (15 families)

5. Family c.37.1.8: G proteins [52592] (20 proteins)

6. Protein Elongation factor eEF-1alpha, N-terminal (G) domain [52631] (1 species)

7. Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [52632] (4 PDB entries)

8. Domain d1f60a3: 1f60 A:2-240 [32140]
   Other proteins in same PDB: d1f60a1, d1f60a2, d1f60b_

Details for d1f60a3

PDB Entry: 1f60, 1.67 Å

PDB Description: crystal structure of the yeast elongation factor complex eef1a:eef1ba

SCOP Domain Sequences for d1f60a3:

Sequence; same for both SEQRES and ATOM records:

>d1f60a3 c.37.1.8 (A:2-240) Elongation factor eEF-1alpha, N-terminal (G) domain {Baker's yeast (Saccharomyces cerevisiae)}
gkekshinvvvighvdsgkstttghliykcggidkrtiekfekeaaelgkgsfkyawvld
klkaerergitidialwkfetpkyqvtvidapghrdfiknmitgtsqadcailiiaggvg
efeagiskdgqtrehallaftlgvrqlivavnkmdsvkwdesrfqeivketsnfikkvgy
npktvpfvpisgwngdnmieattnapwykgweketkagvvkgktlleaidaieqpsrpt

Timeline for d1f60a3:

• d1f60a3 first appeared (with stable ids) in SCOP 1.55
  
• d1f60a3 appears in SCOP 1.59
  
• d1f60a3 appears in the current release, SCOPe 2.08