![]() | Class b: All beta proteins [48724] (178 folds) |
![]() | Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
![]() | Superfamily b.1.2: Fibronectin type III [49265] (2 families) ![]() |
![]() | Family b.1.2.0: automated matches [191562] (1 protein) not a true family |
![]() | Protein automated matches [190976] (5 species) not a true protein |
![]() | Species Human (Homo sapiens) [TaxId:9606] [188649] (68 PDB entries) |
![]() | Domain d5j7cd1: 5j7c D:2-94 [321393] Other proteins in same PDB: d5j7ca_, d5j7cb_, d5j7cc2, d5j7cd2 automated match to d5a41g_ |
PDB Entry: 5j7c (more details), 2.54 Å
SCOPe Domain Sequences for d5j7cd1:
Sequence; same for both SEQRES and ATOM records: (download)
>d5j7cd1 b.1.2.0 (D:2-94) automated matches {Human (Homo sapiens) [TaxId: 9606]} vsdvprdlevvaatptslliswrgypwatyygiiygetggnslvqeftmpgdlshratis glkpgvdytitvyavtrvgrtfdtpgpisinyr
Timeline for d5j7cd1:
![]() Domains from other chains: (mouse over for more information) d5j7ca_, d5j7cb_, d5j7cc1, d5j7cc2 |