Lineage for d5j7cd1 (5j7c D:2-94)

  1. Root: SCOPe 2.07
  2. 2344607Class b: All beta proteins [48724] (178 folds)
  3. 2344608Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2358952Superfamily b.1.2: Fibronectin type III [49265] (2 families) (S)
  5. 2359497Family b.1.2.0: automated matches [191562] (1 protein)
    not a true family
  6. 2359498Protein automated matches [190976] (4 species)
    not a true protein
  7. 2359522Species Human (Homo sapiens) [TaxId:9606] [188649] (64 PDB entries)
  8. 2359565Domain d5j7cd1: 5j7c D:2-94 [321393]
    Other proteins in same PDB: d5j7ca_, d5j7cb_, d5j7cc2, d5j7cd2
    automated match to d5a41g_

Details for d5j7cd1

PDB Entry: 5j7c (more details), 2.54 Å

PDB Description: a picomolar affinity fn3 domain in complex with hen egg-white lysozyme
PDB Compounds: (D:) FNfn10-anti-lysozyme (DE0.4.1)

SCOPe Domain Sequences for d5j7cd1:

Sequence; same for both SEQRES and ATOM records: (download)

>d5j7cd1 b.1.2.0 (D:2-94) automated matches {Human (Homo sapiens) [TaxId: 9606]}
vsdvprdlevvaatptslliswrgypwatyygiiygetggnslvqeftmpgdlshratis
glkpgvdytitvyavtrvgrtfdtpgpisinyr

SCOPe Domain Coordinates for d5j7cd1:

Click to download the PDB-style file with coordinates for d5j7cd1.
(The format of our PDB-style files is described here.)

Timeline for d5j7cd1: