Lineage for d5j9aa2 (5j9a A:96-357)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2974757Fold d.128: Glutamine synthetase/guanido kinase [55930] (1 superfamily)
    duplication: common core consists of two beta-alpha-beta2-alpha repeats
  4. 2974758Superfamily d.128.1: Glutamine synthetase/guanido kinase [55931] (6 families) (S)
  5. 2974891Family d.128.1.2: Guanido kinase catalytic domain [55935] (3 proteins)
    automatically mapped to Pfam PF00217
  6. 2974892Protein Arginine kinase, C-terminal domain [55942] (2 species)
  7. 2974902Species Horseshoe crab (Limulus polyphemus) [TaxId:6850] [55943] (14 PDB entries)
    Uniprot P51541
  8. 2974915Domain d5j9aa2: 5j9a A:96-357 [321383]
    Other proteins in same PDB: d5j9aa1
    automated match to d1m15a2
    complexed with adp, arg, mg, no3

Details for d5j9aa2

PDB Entry: 5j9a (more details), 2 Å

PDB Description: ambient temperature transition state structure of arginine kinase - crystal 11/form ii
PDB Compounds: (A:) arginine kinase

SCOPe Domain Sequences for d5j9aa2:

Sequence; same for both SEQRES and ATOM records: (download)

>d5j9aa2 d.128.1.2 (A:96-357) Arginine kinase, C-terminal domain {Horseshoe crab (Limulus polyphemus) [TaxId: 6850]}
tdkhppkqwgdintlvgldpagqfiistrvrcgrslqgypfnpcltaeqykemeekvsst
lssmedelkgtyypltgmskatqqqliddhflfkegdrflqtanacrywptgrgifhnda
ktflvwvneedhlriismqkggdlktvykrlvtavdniesklpfshddrfgfltfcptnl
gttmrasvhiqlpklakdrkvlediaskfnlqvrgtrgehteseggvydisnkrrlglte
yqavremqdgilemikmekaaa

SCOPe Domain Coordinates for d5j9aa2:

Click to download the PDB-style file with coordinates for d5j9aa2.
(The format of our PDB-style files is described here.)

Timeline for d5j9aa2:

View in 3D
Domains from same chain:
(mouse over for more information)
d5j9aa1