Lineage for d5j1sc_ (5j1s C:)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2739517Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2739518Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2739519Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (33 proteins)
  6. 2742100Protein automated matches [190119] (24 species)
    not a true protein
  7. 2745477Species Vicugna pacos [TaxId:30538] [189756] (82 PDB entries)
  8. 2745481Domain d5j1sc_: 5j1s C: [321378]
    automated match to d4u7sa_
    complexed with atp, cl, mes, mg

Details for d5j1sc_

PDB Entry: 5j1s (more details), 1.4 Å

PDB Description: torsina-lull1 complex, h. sapiens, bound to vhh-bs2
PDB Compounds: (C:) VHH domain BS-2

SCOPe Domain Sequences for d5j1sc_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5j1sc_ b.1.1.1 (C:) automated matches {Vicugna pacos [TaxId: 30538]}
mqvqlvetggglvqaggslrlscaasgnifsfnvmgwyrqapgkqrelvaaitsgdttty
adsvqgrftisrdnaknavylqmnsltpedtavyfcnarrnpingpyyttaywgqgtqvt
vss

SCOPe Domain Coordinates for d5j1sc_:

Click to download the PDB-style file with coordinates for d5j1sc_.
(The format of our PDB-style files is described here.)

Timeline for d5j1sc_: