Lineage for d5ircb_ (5irc B:)

  1. Root: SCOPe 2.07
  2. 2299346Class a: All alpha proteins [46456] (289 folds)
  3. 2338321Fold a.116: GTPase activation domain, GAP [48349] (1 superfamily)
    multihelical
  4. 2338322Superfamily a.116.1: GTPase activation domain, GAP [48350] (3 families) (S)
  5. 2338378Family a.116.1.0: automated matches [227202] (1 protein)
    not a true family
  6. 2338379Protein automated matches [226932] (4 species)
    not a true protein
  7. 2338406Species Norway rat (Rattus norvegicus) [TaxId:10116] [321372] (1 PDB entry)
  8. 2338408Domain d5ircb_: 5irc B: [321373]
    Other proteins in same PDB: d5irca2, d5ircd_, d5ircf_
    automated match to d3fk2a_
    complexed with cl, gdp, mg, mgf

Details for d5ircb_

PDB Entry: 5irc (more details), 1.72 Å

PDB Description: p190a gap domain complex with rhoa
PDB Compounds: (B:) Rho GTPase-activating protein 35

SCOPe Domain Sequences for d5ircb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5ircb_ a.116.1.0 (B:) automated matches {Norway rat (Rattus norvegicus) [TaxId: 10116]}
esnyfgvplttvvtpekpipifiercieyieatglstegiyrvsgnksemeslqrqfdqd
hnldlaekdftvntvagamksffselpdplvpysmqidlveahkindreqklhalkevlk
kfpkenhevfkyvishlnrvshnnkvnlmtsenlsicfwptlmrpdfssmdaltatrsyq
tiielfiqqcpfffyn

SCOPe Domain Coordinates for d5ircb_:

Click to download the PDB-style file with coordinates for d5ircb_.
(The format of our PDB-style files is described here.)

Timeline for d5ircb_: