SCOPe 2.06: Domain d5ircb_: 5irc B:

Lineage for d5ircb_ (5irc B:)

1. Root: SCOPe 2.06

2. Class a: All alpha proteins [46456] (289 folds)

3. Fold a.116: GTPase activation domain, GAP [48349] (1 superfamily)
   multihelical

4. Superfamily a.116.1: GTPase activation domain, GAP [48350] (3 families)

5. Family a.116.1.0: automated matches [227202] (1 protein)
   not a true family

6. Protein automated matches [226932] (3 species)
   not a true protein

7. Species Rattus norvegicus [TaxId:10116] [321372] (1 PDB entry)

8. Domain d5ircb_: 5irc B: [321373]
   Other proteins in same PDB: d5irca2, d5ircd_, d5ircf_
   automated match to d3fk2a_
   complexed with cl, gdp, mg, mgf

Details for d5ircb_

PDB Entry: 5irc, 1.72 Å

PDB Description: p190a gap domain complex with rhoa

PDB Compounds: (B:) Rho GTPase-activating protein 35

SCOPe Domain Sequences for d5ircb_:

Sequence; same for both SEQRES and ATOM records:

>d5ircb_ a.116.1.0 (B:) automated matches {Rattus norvegicus [TaxId: 10116]}
esnyfgvplttvvtpekpipifiercieyieatglstegiyrvsgnksemeslqrqfdqd
hnldlaekdftvntvagamksffselpdplvpysmqidlveahkindreqklhalkevlk
kfpkenhevfkyvishlnrvshnnkvnlmtsenlsicfwptlmrpdfssmdaltatrsyq
tiielfiqqcpfffyn

Timeline for d5ircb_:

• d5ircb_ is new in SCOPe 2.06-stable
  
• d5ircb_ appears in SCOPe 2.07
  
• d5ircb_ appears in the current release, SCOPe 2.08