![]() | Class a: All alpha proteins [46456] (290 folds) |
![]() | Fold a.116: GTPase activation domain, GAP [48349] (1 superfamily) multihelical |
![]() | Superfamily a.116.1: GTPase activation domain, GAP [48350] (3 families) ![]() |
![]() | Family a.116.1.0: automated matches [227202] (1 protein) not a true family |
![]() | Protein automated matches [226932] (4 species) not a true protein |
![]() | Species Norway rat (Rattus norvegicus) [TaxId:10116] [321372] (1 PDB entry) |
![]() | Domain d5ircb_: 5irc B: [321373] Other proteins in same PDB: d5irca2, d5ircd_, d5ircf_ automated match to d3fk2a_ complexed with cl, gdp, mg, mgf |
PDB Entry: 5irc (more details), 1.72 Å
SCOPe Domain Sequences for d5ircb_:
Sequence; same for both SEQRES and ATOM records: (download)
>d5ircb_ a.116.1.0 (B:) automated matches {Norway rat (Rattus norvegicus) [TaxId: 10116]} esnyfgvplttvvtpekpipifiercieyieatglstegiyrvsgnksemeslqrqfdqd hnldlaekdftvntvagamksffselpdplvpysmqidlveahkindreqklhalkevlk kfpkenhevfkyvishlnrvshnnkvnlmtsenlsicfwptlmrpdfssmdaltatrsyq tiielfiqqcpfffyn
Timeline for d5ircb_:
![]() Domains from other chains: (mouse over for more information) d5irca1, d5irca2, d5ircd_, d5ircf_ |